SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340618673|ref|YP_004737126.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340618673|ref|YP_004737126.1|
Domain Number 1 Region: 4-486
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.3e-118
Family N-6 DNA Methylase-like 0.000000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340618673|ref|YP_004737126.1|
Sequence length 487
Comment type I restriction enzyme ZgaDI, M subunit [Zobellia galactanivorans]
Sequence
MSADEIANKLWNLCNVLRDDGVTYHQYLNELTYILFLKLSEVKGFEEHIPEQYRWRSFVE
ETDNAEAFQRYRSFLAEVSNETTSAGIKEIYANASTSLRKPVNFNTLVQAIDDLDWYEET
DRDVMGDIYESLLEKNAGEKKSGAGQYFTPRPLINVMVELVSPKLGERWNDPAAGTFGFM
ISADEYLRTKHDNYFDLDEKRRKFQVEKAFSGVELVGDAHRLALMNARLHGMESQIILGD
TLTEMGKELKNFDGVLANPPFGTKKGGERPTRDDFTYPTSNKQLNFLQHIYRSLKKDGKA
RAAVVLPDNVLFEDGDGQKIRRDLMDKCNLHTILRLPTGIFYAAGVKTNVLFFTRGTTET
KNTKGVWFFDMRTNVPNYGKRTPFTRAAFNEFIEAYTGGIKPEKLATDFDGTIDETARKK
VTNERWQYIDRKTIAKKNDSLDLGLIADDSVSNGEDLGEPIDIAKEALTELKTITEQLQE
MINELGS
Download sequence
Identical sequences G0L6C6
gi|340618673|ref|YP_004737126.1| WP_013994043.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]