SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|340618777|ref|YP_004737230.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340618777|ref|YP_004737230.1|
Domain Number 1 Region: 88-283
Classification Level Classification E-value
Superfamily Formyltransferase 7.98e-59
Family Formyltransferase 0.00032
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily ACT-like 0.000000000000042
Family SP0238-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340618777|ref|YP_004737230.1|
Sequence length 283
Comment formyltetrahydrofolate deformylase [Zobellia galactanivorans]
Sequence
MKTTILIHCPDQAGIISAVTNFIHQHHGNIIYLDQHVDKEANVFFMRLDSDFDLSTFSKE
TFKKEFQKELADRYNMQWSLHEAGIKPKMAIFVSKYNHCLYDLLSRFNSSELEVEIPFII
SNHPDLKPIAEQFDIPFYHIPVTKDTKAEAETKQLELLKKHGVDFIVLARYMQIVSPKII
SNFPNRIINIHHSFLPAFAGAKPYHAAFKRGVKIIGATSHYVTEELDAGPIIEQDVTTVT
HAHSIKDFIAKGRDLEKIVLSRAVKLHILRKTMVYNNKTVIFS
Download sequence
Identical sequences G0LCI5
gi|340618777|ref|YP_004737230.1| WP_013994146.1.92583 WP_013994146.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]