SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340618794|ref|YP_004737247.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340618794|ref|YP_004737247.1|
Domain Number 1 Region: 18-96,138-218
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.000000000000381
Family Spermidine synthase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340618794|ref|YP_004737247.1|
Sequence length 219
Comment hypothetical protein zobellia_2821 [Zobellia galactanivorans]
Sequence
MERKIITTGDGSKTIQITDWDEQYHSKHGAVQEAYHVFIKHGLALFTGKDISILEIGFGT
GLNALITYIESEKNGGRLRYTGVEAYPVSEVEMAQLNYIGELDAEAYENDFKRMHNSDWG
CDIHISNDFMLRKEQKFFADITDENAFDLVYFDAFGARVQPELWTEDIFAIMYRAMRKDG
VLVTYAAKGSVRRAMQAVGFEVERLPGPPGKREMLRARK
Download sequence
Identical sequences G0L6I2
gi|340618794|ref|YP_004737247.1| WP_013994163.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]