SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340618948|ref|YP_004737401.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340618948|ref|YP_004737401.1|
Domain Number 1 Region: 8-75
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000247
Family DNA-binding N-terminal domain of transcription activators 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340618948|ref|YP_004737401.1|
Sequence length 299
Comment MerR family transcriptional regulator [Zobellia galactanivorans]
Sequence
MNNIKKSFSIRDLENLSGIKAHTIRIWEKRYNLLSPERTDTNIRRYSLESLQKLLNITLL
YNNGYKISKIAHFEEGKIPQLVTDITSKSHTEDYIANTFKMAMINFDQALFTQTYNSLLE
KYTFSEIFRETFVPLLNELGILWQTDTISPAHEHFVANLIKQKIILKTEEMAGVQSVTKT
PVIVPYLPENEIHEIGLLFLNYEIVSKGYKSIYLGQTVPLKNLQELMKTFEDAHFISYFT
VSPTKDKIEEYVAEFASLASDYPQAKLWLLGYQTQYLDPHKLPSCIKLFGSIDKVIEQL
Download sequence
Identical sequences G0KZQ7
WP_013994316.1.951 gi|340618948|ref|YP_004737401.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]