SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340619009|ref|YP_004737462.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340619009|ref|YP_004737462.1|
Domain Number 1 Region: 244-535
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.4e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000334
Further Details:      
 
Domain Number 2 Region: 65-242
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.02e-55
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000248
Further Details:      
 
Domain Number 3 Region: 538-643
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.03e-28
Family Anticodon-binding domain of Class II aaRS 0.0002
Further Details:      
 
Domain Number 4 Region: 5-64
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000024
Family TGS domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340619009|ref|YP_004737462.1|
Sequence length 648
Comment threonyl-tRNA synthetase [Zobellia galactanivorans]
Sequence
MGKMKITLPDGSIREYAKGSTPMDIAKSISEGLARNVISAKFNDTVVETVTPLNEDGALV
LYTWNDKEGKKAFWHSSSHIVAQALEELYPGIKLTIGPAIENGFYYDVDFGEHTISEKDF
PAIEKKALEIARGKHDFKMRPVSKADALALYKKQGNEFKVELIENLEDGTISFCDHDTFT
DLCRGGHIPNTGIVKAIKILNVAGAYWRGDENKPQLTRVYGISFPKQKELTEYLALIEEA
KKRDHRKLGKELELFTFSQKVGQGLPLWLPKGAALRERLENFLKKAQKKAGYEMVVTPHI
GQKELYVTSGHYEKYGADSFQPIHTPKEDEEFLLKPMNCPHHCEIYNSRPFSYRELPKRY
AEFGTVYRYEQSGELHGLTRVRGFTQDDAHIFCTPDQLDEEFKSVIDLSLYVLGSLGFED
FTAQVSVRDLDTPEKYIGTVENWEKAENAIINAAQEKGLDYIIEKGEAAFYGPKLDFMVK
DALGRQWQLGTIQVDYNLPERFDLTYKGSDNELHRPVMIHRAPFGSMERFIALLLEHTGG
NFPLWLIPEQAIVLPVSEKHEKYAEKVLKSLENDEIRALIDDRNETVGKKIREAEMNKIP
FMLIVGENEEASNTISVRRHGGEDLGSISLEQFSDLVTKEINSTLKSF
Download sequence
Identical sequences G0LCT8
gi|340619009|ref|YP_004737462.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]