SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340619093|ref|YP_004737546.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340619093|ref|YP_004737546.1|
Domain Number 1 Region: 136-214,251-369
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.37e-37
Family N5-glutamine methyltransferase, HemK 0.072
Further Details:      
 
Domain Number 2 Region: 46-149
Classification Level Classification E-value
Superfamily THUMP domain-like 0.00000366
Family THUMP domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340619093|ref|YP_004737546.1|
Sequence length 384
Comment RNA methylase [Zobellia galactanivorans]
Sequence
MVAKTLFGFEEILAKEIRNLGGGNVVEGVRNVAFEGDTGFMYKANLCLRTAIKIIKPIHS
FSVRNENELYKKIYAMDWAEYLSVDTTFAIDSTVNSDNFTHSLYVSQKVKDAIVDKFRDM
DGSRPNVDVKFPDVRINIHIHNEHCNVSLDSSGRSLHQRGYRTATNIAPINEVLAAGLLL
MSGWDGQCDFLDPMCGSGTMLTEAAMIACNIPVNINRKEFAFEKWHDFDQDLFDKIVEVS
LNKVREFHYKIVGYDKAPSAVRKAIDNVENANLSEYISIERKNFFDTEKFTEGKLHMVFN
PPYGERLSLDMEDFYASIGDTLKQKYPGTEAWFITSNMEALKYVGLRPSRKIKVFNSHLE
SRLVKYVMYEGSKKAKYMNKNKEE
Download sequence
Identical sequences G0KZZ0
gi|340619093|ref|YP_004737546.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]