SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340619096|ref|YP_004737549.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340619096|ref|YP_004737549.1|
Domain Number 1 Region: 80-477
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.35e-76
Family (Uracil-5-)-methyltransferase 0.00032
Further Details:      
 
Domain Number 2 Region: 19-68
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000268
Family TRAM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340619096|ref|YP_004737549.1|
Sequence length 478
Comment 23S rRNA (uracil-5-)-methyltransferase RumA [Zobellia galactanivorans]
Sequence
MHRDAYFCGMRRKNKRQVFENVEVVDAGAKGKTIGKAPDGRVIFLTNAVPGDIVDVQTTK
KRKAYFEGVATTFHNFSDKRVEPQCEHFGVCGGCKWQNMGYEHQLFYKQKEVENNLRRIG
HLELPEITPISGSKEQYFYRNKMEFSFSDSRWLTLKEIQSDNNFTDKNALGFHIPGMWDK
ILDIKKCHLQQDPSNAIRLETRDFAIKNGLTFFNPRNQHGQLRTLMIRTASTGELMVMIQ
FYEDDKAKRELLLNHLKATFPEITSLLYVINQKQNDTIYDQEIVCFSGRDHIFEEMEGLK
FKINAKSFYQTNSAQAYELYKLTREFADLKGDELVYDLYTGTGTIAQFVAKKAKKVVGIE
SVPEAIADAKANAERNEIDNVDFFVGDMKNVFNQEFIEANGTPDVIITDPPRDGMHKDVV
QQILNIAPDKVVYVSCNSATQARDLALMKDTYQVIKVQPVDMFPQTHHVENIVLLKKL
Download sequence
Identical sequences G0L7A8
gi|340619096|ref|YP_004737549.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]