SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340619808|ref|YP_004738261.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340619808|ref|YP_004738261.1|
Domain Number 1 Region: 917-1081
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.37e-42
Family Histidine kinase 0.002
Further Details:      
 
Domain Number 2 Region: 391-497
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.99e-27
Family Flavin-binding PAS domain 0.0005
Further Details:      
 
Domain Number 3 Region: 20-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.34e-25
Family Heme-binding PAS domain 0.0096
Further Details:      
 
Domain Number 4 Region: 509-663
Classification Level Classification E-value
Superfamily GAF domain-like 5.23e-19
Family GAF domain 0.0072
Further Details:      
 
Domain Number 5 Region: 845-929
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 8.04e-19
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 6 Region: 146-254
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.29e-18
Family Heme-binding PAS domain 0.046
Further Details:      
 
Domain Number 7 Region: 249-357
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000435
Family Heme-binding PAS domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340619808|ref|YP_004738261.1|
Sequence length 1092
Comment two-component system-sensor histidine kinase [Zobellia galactanivorans]
Sequence
MVEKLKDNDLFKGIFESSVEGIIVVDYKGRIFRANPSVEKMFGYGPGELAHKTVEDLVPG
QYGKSHQNHRKNFAKKPTSRPMGKGGNLWALRKDGSQFPVEISLSPTQINDENVVVAFVI
DITDRLLAEKKAAVSAEKMNEAQSLAHIGSWVWNLRTNERNWSDEFYRICGLPPGDKRLN
VDTVLQFIHPDDRQATIDDIAYAIENKTSYSNNKRMVRTDGSIRYITARGKASYDNEGKP
LEWFGTIQDVTEQKATEQQLEENLTKNKALLEALPDMMFILDYEGEFLDYYVPEPEKLFA
PASSIIGGHIKELLPPHICQAIRDGIDKTIKTNEIQFVEYNFDGEKGRQFYEGRIVPMDK
NRLLTIIRDITNERAIENILYVRNQALAATANGIIICDAREPDHPIIYANEAFCKTTGYD
EDDFMGKNCRFLQREDKDQFEIKLMSEAIRNGEDCRVVLRNYRKDGSLFWNEVSITPIYN
EEKVLTHFVGVHNDVTAHKVEEFFKIGQSHVMDMIIQHEPLEHIAYKIVETIETAIPNCH
GSILLLDKETGSLRQLAAPNVPKSFTDAIEGMQIGAENGSCGAAAYLKKEIIVSDTSSDP
LWSAFRELAEEANLKACWSFPIFSSNQELLGTFAIYFNVSRIPLDTEKEIIYNITQATSV
AIEQHNISAALRKSREELAVYAEALENKVAERTVELKDMVRKLVESNMNLEDQIQITKTA
ENSAIASQELLVTIFRNFPKGFVGVVDMHLRVVFIEGEDLDTLNFRKAIQVGDTIDELNN
VPAELKKKVKQNVLKTLKGEHRSFEAKVQGKSYLVNTTPLFNEEQEVVQALIVYNNISDQ
KRVEVEIRNTLQKEKELNELKSRFISMASHEFRTPLSAILSATNLIERRNGDGQEEKRTK
YIQTIKGSVKNLVDILNDFLSLSKLEEGKVVAQPILFDFVEFIEVLVEEVQGVKKNGQTI
DVINSRSRIEVGLDTKLLRHIVHNLLSNAIKYSEEHKPITLKIDTKDDKLFIEVADRGIG
IPAEDQDYLFQRFYRAKNATNFQGTGLGLNIVRQYTLLMNGTISFRSQLGQGTTFIVELP
LNLLTNEKNTAY
Download sequence
Identical sequences G0L288
gi|340619808|ref|YP_004738261.1| WP_013995172.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]