SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340620125|ref|YP_004738578.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340620125|ref|YP_004738578.1|
Domain Number 1 Region: 595-746
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.02e-22
Family Histidine kinase 0.0031
Further Details:      
 
Domain Number 2 Region: 399-510
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.62e-21
Family Heme-binding PAS domain 0.0087
Further Details:      
 
Domain Number 3 Region: 150-257
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.62e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.045
Further Details:      
 
Domain Number 4 Region: 278-382
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000436
Family Flavin-binding PAS domain 0.068
Further Details:      
 
Domain Number 5 Region: 20-130
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000279
Family Flavin-binding PAS domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340620125|ref|YP_004738578.1|
Sequence length 746
Comment two-component system-sensor histidine kinase [Zobellia galactanivorans]
Sequence
MGVNNHKNSIDSDTMNSIHERLRMGTWKLNVVTGEYTLDDITCDILQIPHDTVLKRGIKP
PMDRPDTTGLQIEEGLRELIHSGTPFDHELEFTTPKGNPRWLHVIATRKPENGKCIEVLG
IIQDITTRKQTENNLFQHNKLLNLAQRKARLGHWNWDFRTNTFSCSENMSRIIGFEPDVP
VSMSSVLDNIHPDDRTYVDALLTNCIKNKEFQSFTHRMILEDGSMRTIQVSGDIYVDEEG
EIINVLGISQDISDYKEIEEELLKKNELLIFAEQKALLGHWEWNIITDEVFWSSNLYYLF
KQEENTKLEFNTYYSYVHVEDQAKVSAHFGKAIEEKHFEKIIHRIVLNDGTLKWILLLGE
VVVNEQDAIIKLIGTCQDVTEQQMQEIKFKGLVESAPSATIIIDKEGIIQMVNKQAESLF
GYTPEELVEKSVEVLIPARFEEKRAPHREKFLANPKIQKIDIGEDFYMIHKSGREIPVNI
TLGPLHIEEGLLISMSIRDTTAQKMAERKILKAKEDLEILTKELTAQNHQLADFTQITSH
NLRAPVSNLNSLLEIYKLMDNEEERKELFGKFEIVIGHLTLTLNTLVEALSVKNHTSIER
SEVSLSETLLKTEEIFTAEISRTKAVIKGDFSEIDSVHYNKIYLESIFQNLIGNGLKYRS
SERMPVIEVSSEVRSGRVLLRFQDNGLGVDLNRHGHKMFGLNKVFHNHPEAKGIGLFMTK
TQVEAMGGKIAVSSKVNEGSTFTITL
Download sequence
Identical sequences G0L300
gi|340620125|ref|YP_004738578.1| WP_013995487.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]