SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340620127|ref|YP_004738580.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340620127|ref|YP_004738580.1|
Domain Number 1 Region: 723-872
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-23
Family Histidine kinase 0.0047
Further Details:      
 
Domain Number 2 Region: 527-636
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.31e-17
Family Heme-binding PAS domain 0.0081
Further Details:      
 
Domain Number 3 Region: 150-257
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.48e-17
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.072
Further Details:      
 
Domain Number 4 Region: 402-509
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000343
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.07
Further Details:      
 
Domain Number 5 Region: 277-383
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000495
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.069
Further Details:      
 
Domain Number 6 Region: 23-130
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000506
Family Heme-binding PAS domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340620127|ref|YP_004738580.1|
Sequence length 873
Comment two-component system-sensor histidine kinase [Zobellia galactanivorans]
Sequence
MCIKDRPIENIDDRIADLNVIARIGYWEFDVDLESYRLDKVSYDILQLPYGAALEDQETE
TYCQNKDEWAVVSNLIATTAKRKKPFHHEVELELPDGNHIWLLLIGKISYDTNRNIKVSG
MMQDITDRKEFETELTQKNELLNFTENKAALGHWKWDLKTDLVSCSKNIARIIGVAYGTV
VTIEELINGVHPEDLELVRNHLEKAVKTKSFDPLFHRFLLDDGSERTIEVLGKPVLDDSG
KLVSFICSSQDITTRKQFENELIKKNQLFIVAQQRAKFGYWQWDPKTDSVNCSENMSRLL
RIEENTTFPIKDLIKDVHPNDIDYVRSCLNKVVKTKTFNGFSHRIVLNDEIRYVKVYGKV
NTDLNDEILNILGVSQDVTEQKKSENELLSKNQLLGFAEQISKIGNWQWNMTTNIIKWST
NLYRIFEIEENSEVHFDTYFGHVHPDDKEMVTTKINSLAENKNFESVIHRIVLNNGTIKV
VELLATVNLDDSDNIIEMLGTLQDVSEQRSEEIKFRGLLESAPNATLIVGEGDSIQMINK
QAELLFGYTPEELIGKNFEILVPSRFEEMRIPQKKKFFENPVVQEMDLGEDFFMKHKSGK
EIPVKVTLGLLEIDKGLLISMAVRDITTEKLAERKILKAKEDLEVLTRELTAQNLQLADF
TQITSHNLRAPVSNLNSLLDIYKMMDDEEERKELFEKFETVIAHLTLTLNTLINALSTKS
NTSVECHAVSFSETFKKTEEILTAEIIRTKAIIKSDFSKVDSIQYHKIYLESIFQNLIGN
ALKYKSPERIPQIEVSSEIHNGKVLLKFKDNGLGIDLERHGDKIFGLNKVFHNHPEAKGI
GLFMTKTQVEAMGGKISVSSKVDEGSTFIISFK
Download sequence
Identical sequences G0L301
gi|340620127|ref|YP_004738580.1| WP_013995489.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]