SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340620349|ref|YP_004738802.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340620349|ref|YP_004738802.1|
Domain Number 1 Region: 36-163
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.47e-17
Family CAC2371-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340620349|ref|YP_004738802.1|
Sequence length 234
Comment hypothetical protein zobellia_4388 [Zobellia galactanivorans]
Sequence
MADFLKRNRETELMDDLSLDETRLNAVLLDIDRANRLLNGNNLTIKAVEALISEHPKESY
TILDMGCGNGSMLRSVVLWARKRKISIACMGVDLNGKSLALAREQSRDFPEIIYLQQDIL
ALRPDELPCDILLCTLTMHHFKDEEIPRFLDQFSKLGRIGFIINDLQRSVWAYYLFKLFS
TIFIRTDIAKQDGLTSIKSGFVKGELEAFAEKLPQMRHSIEQKWAFRYLWLAQH
Download sequence
Identical sequences G0L3N1
gi|340620349|ref|YP_004738802.1| WP_013995711.1.92583 WP_013995711.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]