SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340620401|ref|YP_004738854.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340620401|ref|YP_004738854.1|
Domain Number 1 Region: 187-256
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.02e-16
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0071
Further Details:      
 
Domain Number 2 Region: 43-156
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000471
Family BphP N-terminal domain-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340620401|ref|YP_004738854.1|
Sequence length 258
Comment LuxR family transcriptional regulator [Zobellia galactanivorans]
Sequence
MTKTSIDLFKEIFNTNKEYQNTIIENHLNKLRELDEYLPHNESFFIVTNTTTQKYAFVSK
NFEYALGLDRIKMCDIGAKYWLSYFHPDDLAVWMGALEDLMHFTMTKVKQEDRNKLNYTW
NFRVKNSKGKYCNILEHQTPTYFDENGKPIIGIAHCTVTGKGEYRPIVCLIKKLNENNEY
EILYHKNYSQKLINTNSLTNREHDVIRLLALNKTSREIGEKLFISSHTVDGHRRNILKKL
NFDSTQKLVQYCLLNQLF
Download sequence
Identical sequences G0L415
gi|340620401|ref|YP_004738854.1| WP_013995762.1.92583 WP_013995762.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]