SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340618741|ref|YP_004737194.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340618741|ref|YP_004737194.1|
Domain Number 1 Region: 10-288
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.22e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000108
Further Details:      
 
Domain Number 2 Region: 289-416
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.32e-34
Family Anticodon-binding domain of Class II aaRS 0.0000757
Further Details:      
 
Domain Number 3 Region: 419-491
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 8.63e-22
Family C-terminal domain of ProRS 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340618741|ref|YP_004737194.1|
Sequence length 491
Comment prolyl-tRNA synthetase [Zobellia galactanivorans]
Sequence
MGKNLTKRSEDYSKWYNELVVKADLAENSGVRGCMVIKPYGFAIWEKMQAALDKMFKETG
HENAYFPLFIPKSYLSKEASHVEGFAKECAVVTHYRLKNAEDGSGIIVDPDAKLEEELIV
RPTSETIIWDTYRRWIQSYRDLPLLINQWANVVRWEMRTRLFLRTAEFLWQEGHTAHATE
AEAIEEAEKMMRVYAEFAEEHMAMPVIQGVKTESERFAGAIETYCIEALMQDGKALQAGT
SHFLGQNFAKAFDVKFANKEGKQEHVWATSWGVSTRLVGALIMSHSDDNGLVLPPKLAPI
QVVIVPIYKGMEQLDAISEKVAPLVKELRAKGISVKFDNRDTHKPGFKFNEYELKGVPVR
LAIGKRDLENGTYEVARRDTLTKEIVPMDDVVAKIEFLLEDIQKNIYQKAHSFREDNITE
VDTYEEFKKVLEEKGGFISAHWDGTNETEEKIKEETKATIRCIPLGTENKEGKCMVTGKL
SSKRVLFAKAY
Download sequence
Identical sequences G0L6G6
WP_013994111.1.951 gi|340618741|ref|YP_004737194.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]