SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340619865|ref|YP_004738318.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340619865|ref|YP_004738318.1|
Domain Number 1 Region: 19-206
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.89e-53
Family Methylesterase CheB, C-terminal domain 0.00022
Further Details:      
 
Domain Number 2 Region: 286-480
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.48e-38
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00098
Further Details:      
 
Domain Number 3 Region: 1176-1324
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.19e-35
Family Histidine kinase 0.00047
Further Details:      
 
Domain Number 4 Region: 985-1101
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.66e-22
Family Heme-binding PAS domain 0.063
Further Details:      
 
Domain Number 5 Region: 852-967
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.74e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.052
Further Details:      
 
Domain Number 6 Region: 1097-1176
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000157
Family Homodimeric domain of signal transducing histidine kinase 0.0042
Further Details:      
 
Domain Number 7 Region: 216-288
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000144
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340619865|ref|YP_004738318.1|
Sequence length 1326
Comment two-component system hybrid-sensor histidine kinase/Chemotaxis proteins [Zobellia galactanivorans]
Sequence
MTQPTSPSTENQHIKSQKNEFSIIGVGASAGGLEALKSFFEDLPAKFAHSFVVVQHLSPD
YKSLMGELLSKNTDMPIIEVKKKTKVEPGTIYLLTPKKNIFVKDGHLLLENKPTDRTLNL
PIDLFFKSLAREKTNKAIAVILSGTGSDGTSGARDIKEFGGMVMVQDPEQAEFESMPQNA
INTHLVDYVLPTEQMGEELQRFMQHPAVYGSLEESILKDEETLIKILNFVNSQTKLDFEY
YKRPTLIRMIARRIGVKRLDSLQEYKDFLLERPEEAHFLIREFLVGVTSFFRDDTVWDLL
TNEIIPKLIYDKKKNDTIKCWCVGVSSGEEAYSLAIIINEELAKQNKKNLVKIFATDIEK
NHLKDGSKGIYNESSVSNIPEKRLLANFTKKGDSYHINENIRRMVIFSKHNVLKDPPFNK
MDISFCRNMLIYLQPAAQNKVLDVLHYSLNRNGILVLGSSESLSRQKNAFEELHRKQKIY
RNIRPAKILGLQPYNSKNTLRNSFGTETIGYERNTKQFIVEALSDNLHLASIVIDSNFNI
VDAYGELSNYISLPNKGFSMNLLKMVPESIAMVLSYSIRKVGTTNQKLKHENLNFSTGKE
PVMANMHVASFQNPLNSNPSNFLVIIKPVELQSSHTLVLEETNVVPKNTRERELESELKE
TRESLKNMIEEVETSNEELQATNEELLASNEELQSTNEELQSVNEELHTVNAELQEKIEE
LAMLNSDLDNLFKSTDIGTVFLDKELRIRKFTPSVAKHFNLLENDVNRPLEHFASSFHKN
NYKEFISDIKSVIINHVPKESEVKDAKGQWFLQKIVPFQDGGGNVAGATLSYVDINKLKS
AEQRLQNQQLAIEQTTDSFWDLNIADNTYYVSHSIAEVLGYHKDEIEETIEFWSALAHPG
DLKIQIEAMQKHIDSQGKEPYAVETRYKHKLGHYVTLLLRGKIMEWTEDGQPKRMIGTTT
DVSMLKKLPKLEQDLLDRNMVFEQVLEITMAGFWDWNIAENSEYLSPTFKKMFGYDEHEM
TGSAESWQRIVHPDDLPGVLEKLDAHVKSKGEIPYDNEIRYFHKNGSIVWVWCKGLVIEW
GENGEPKRMVGSHINITQLKQLSRSNKELERFAYVASHDLQEPLRTIRDFVALFKDEYNT
LLDNRANTYLEFIEEASSRMGELVKVILAYSKIGSNTKKEIVNLKEVVENVQKDLQIRID
STKTKILIKELPTLTGHRVELHSLFLNLIGNSIKFISKDESPRIEIGTLTCEKGEHIYIR
DNGIGIDKKNQEHIFQVFKRLHNQEDYEGTGIGLAHCKKIVELHNGKIWVESEMGKGSTF
HFNLNL
Download sequence
Identical sequences G0L889
gi|340619865|ref|YP_004738318.1| WP_013995229.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]