SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340620687|ref|YP_004739140.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340620687|ref|YP_004739140.1|
Domain Number 1 Region: 216-409
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.67e-69
Family B3/B4 domain of PheRS, PheT 0.00000914
Further Details:      
 
Domain Number 2 Region: 43-202
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-43
Family Myf domain 0.0021
Further Details:      
 
Domain Number 3 Region: 711-809
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.01e-28
Family Anticodon-binding domain of PheRS 0.0013
Further Details:      
 
Domain Number 4 Region: 481-701
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.58e-28
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0013
Further Details:      
 
Domain Number 5 Region: 418-489
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000293
Family Domains B1 and B5 of PheRS-beta, PheT 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340620687|ref|YP_004739140.1|
Sequence length 809
Comment phenylalanyl-tRNA synthetase subunit beta [Zobellia galactanivorans]
Sequence
MQISYNWLKQFLKLDWDSQKTAELLTDLGLEVEGITPFESIKGGLKGIVVGHVLSCTKHP
NADKLKVTTVDIGAESPVQIVCGAPNVDKGQKVPVATVGTKLYTPEGKVWKIGKGKIRGE
ESHGMICAEDELGLGSDHEGILVLDSKLKPGTPCSEIFDVEQDEVFEIGLTPNRADAMSH
YGVARDLKAGLIQKEINKELITPSISQFNVDNRSLKLQVDVVDSKLVPRYAGITLSNLTI
KPSPKWLQNRLRAIGINPTNNVVDATNYVLHELGQPLHAFDADRIHGKKVIVKTLPAGTK
FMTLDGEERTLHEDDLMICDSEKPMCIAGVFGGINTGVTEKTNSIFLESAYFNPVSIRKT
AKRHGLNTDASFRFERGIDIENVEYALKRAALLIKEIAGGDITSDIIDFYPKRFDEHQVF
LTFRKTYSLVGQEIPQDTIKSILTSLDIKVKSVTEAGLGLSIPSYRVDVQREVDVIEEIL
RVYGYNNIDFGTKLNASTAPVSKFDDHRLQTVIGDLLASKGFYEIMTNSLTAPANAQLID
ESETDEKSVQMLNPLSNDLSIMRRSMLYTGLETVLYNNNRKKHNLKLFEFGKSYEQQDTK
YIEDKHLCLYLTGNRSESNWSREVKAIDFFYLKSIVLNILARLGITDAISEPTSNSAFSE
GLSLAVNTKEVVSFGLIKKSILKKMNLKQEVLYADFNWDNVIALAQKNSITYREIPKYPE
VKRDLALLLDDAVSFKQVYDLGRKTEKKLLKDINLFDVYVGDKLPKGKKSYAVSFTLQDS
QRTLTDKQIDRIMGKLQKTYQTELGAELR
Download sequence
Identical sequences G0L4R7
WP_013996048.1.92583 WP_013996048.1.951 gi|340620687|ref|YP_004739140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]