SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|315453721|ref|YP_004073991.1| from Helicobacter felis ATCC 49179

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315453721|ref|YP_004073991.1|
Domain Number 1 Region: 83-175
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.83e-33
Family Ribosomal protein L6 0.0000465
Further Details:      
 
Domain Number 2 Region: 2-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.14e-16
Family Ribosomal protein L6 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|315453721|ref|YP_004073991.1|
Sequence length 178
Comment 50S ribosomal protein L6 [Helicobacter felis ATCC 49179]
Sequence
MSRIGKRVIKIPSGVQVNVEGTNLHFKNSKTSQVLETRGRVNIVLEGDSLRFEPVGEGAQ
SRAFWGTYNALAHNIVVGLDKGFSKVLEINGVGYKAALGHKVLELSLGFSHPVKHPIPEG
VEVVVDKNTITLKGSDKQQIGQLAADIRAYRPPEPYKGKGIKYSDEIILRKAGKTAKK
Download sequence
Identical sequences E7A9T1
WP_013469765.1.44168 gi|315453721|ref|YP_004073991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]