SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433630278|ref|YP_007263906.1| from Mycobacterium canettii CIPT 140070010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433630278|ref|YP_007263906.1|
Domain Number 1 Region: 1-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.89e-105
Family FMN-linked oxidoreductases 0.0000000144
Further Details:      
 
Domain Number 2 Region: 335-517
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.1e-41
Family N-terminal domain of adrenodoxin reductase-like 0.0000226
Further Details:      
 
Domain Number 3 Region: 462-520,555-652
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.28e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0000758
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|433630278|ref|YP_007263906.1|
Sequence length 674
Comment Putative NADPH dependent 2,4-dienoyl-coa reductase FadH (2,4-dienoyl coenzyme A reductase) (4-enoyl-CoA reductase) [Mycobacterium canettii CIPT 140070010]
Sequence
MTNPYPNLLSPLDLGFTTLRNRVVMGSMHTGLEDRARHIDRLADYFAERARGGVGLIITG
GYAPNRTGWLLPFASELVTSAQARRHRRITRAVHDSGAKILLQILHAGRYAYHPLSVSAS
PIKAPITPFRPRALSARGVEATISDFARCAQLARDAGYDGVEIMGSEGYLLNQFLAPRTN
KRTDSWGGTPANRRRFPVEIIRRSRAAVGSDFIICYRLSMADYVAEGQSWDEIVALATEV
EGAGATIINSGFGWHEARVPTIVTSVPGGAFVDISNAVAEHVTIPVVASNRINMPQAAER
ILAETQVRLISMARPMLSDPDWVLKAQSNRVDEINTCISCNQACLDHAFARKTVSCLLNP
RAGRETQLVLSPTRRARSVAVVGAGPAGLATAANAAQRGHRVTLFEANDFIGGQFDMARR
IPGKEEFSETIRYFSTILAKHGVEVRLGTRVAARELTGYDEVVLATGVAPRIPAIPGIDH
PMVLTYAEAITGVRPVGRTVAVVGAGGIGFDVTELLVTDSSPTLNLKEWKAEWGVADPRE
ARGALTTPLPAPPAREVYLLQRTKGPQGKRLGKTTGWVHRASLKAKGVHQLSGVNYERIN
DDGLHISFGPKRRRPQLLAVDNVVVCAGQEPVRDLESELRRHGINPHIIGGAALAAELDA
KRAIKQGTELAARL
Download sequence
Identical sequences gi|433630278|ref|YP_007263906.1| WP_015289633.1.35403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]