SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433631493|ref|YP_007265121.1| from Mycobacterium canettii CIPT 140070010

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433631493|ref|YP_007265121.1|
Domain Number 1 Region: 3-240
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000165
Family C-terminal domain of adrenodoxin reductase-like 0.065
Further Details:      
 
Weak hits

Sequence:  gi|433631493|ref|YP_007265121.1|
Domain Number - Region: 196-234,272-337
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00015
Family Siroheme synthase N-terminal domain-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|433631493|ref|YP_007265121.1|
Sequence length 431
Comment Lysine-N-oxygenase MbtG (L-lysine 6-monooxygenase) (Lysine N6-hydroxylase) [Mycobacterium canettii CIPT 140070010]
Sequence
MNPTLAVLGAGAKAVAVAAKASVLRDMGVDVPDVIAVERIGVGANWQASGGWTDGAHRLG
TSPEKDVGFPYRSALVPQRNAELDERMTRYSWQSYLIATASFAEWIDRGRPAPTHRRWSQ
YLAWVADHIGLKVIHGEVERLAVTGDRWALCTHETTVQADALMITGPGQAEKSLLPGNPR
VLSIAQFWDRAAGHDRINAERVAVIGGGETAASMLNELFRHRVSTITVISPQVTLFTRGE
GFFENSLFSDPTDWAALTFDERRDALARTDRGVFSATVQEALLADDRIHHLRGRVAHAVG
RQGQIRLTLSTNRGSENFETVHGFDLVIDGSGADPLWFTSLFSQHTLDLLELGLGGPLTA
DRLQEAIGYDLAVTDVTPKLFLPTLSGLTQGPGFPNLSCLGLLSDRVLGAGIFTPTKHND
TRRSGEHQSFR
Download sequence
Identical sequences WP_015290622.1.35403 gi|433631493|ref|YP_007265121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]