SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319899972|ref|YP_004159700.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319899972|ref|YP_004159700.1|
Domain Number 1 Region: 186-450
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-62
Family Tandem AAA-ATPase domain 0.00000135
Further Details:      
 
Domain Number 2 Region: 388-595
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.55e-40
Family Tandem AAA-ATPase domain 0.000011
Further Details:      
 
Domain Number 3 Region: 6-177
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.4e-31
Family RecG "wedge" domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319899972|ref|YP_004159700.1|
Sequence length 698
Comment ATP-dependent DNA helicase RecG [Bacteroides helcogenes P 36-108]
Sequence
MFDLVTRDIKYLSGVGPQRASVLNKELGIYSLHDLLYYFPYKYVDRSRIYHIQEIDGTMP
YIQLKGEILHFETVGEGRQRRLIAHFSDGTGMVDLVWFQGIKYLLGQYKVHQDYVVFGKP
TAFNGRINIAHPDIDPVSELKLSTMGMQPYYNTTAKMKRSSLNSHAIEKMMSTVIQQLRE
PIPETLSPAILNEHHLMSLTDALTNIHFPVNSELLRKAQYRLKFEELFYVQLNILRYAKD
RQRKYRGYIFEKVGEIFNSFYSRNLPFELTNAQKRVLKEIRRDVGSGKQMNRLLQGDVGS
GKTLVALMSMLIALDNGFQACMMAPTEILANQHYETICELLYDMDVRVELLTGSVKGKRR
ETILADLLTGDVHILIGTHAVIEDKVNFASLGLVVIDEQHRFGVAQRARLWTKSIQPPHV
LVMTATPIPRTLAMTLYGDLDVSVIDELPPGRKPIATIHQFDNRKESLYRSVRKQIAEGR
QVYIVYPLIKESEKIDLKNLEEGYLHICEEFPDCKVCKVHGKMKPAEKDAQMQLFVSGEA
QIMVATTVIEVGVNVPNASVMIIENAERFGLSQLHQLRGRVGRGADQSYCILVTGYKLAE
DTRKRLEIMVRTNDGFEIAEADLKLRGPGDLEGTQQSGIAFDLKIADIARDGQLLQYVRE
IAQKVIDADPTGALPENEILWRQLKTLRKTNVNWAAIS
Download sequence
Identical sequences E6SRV5
WP_013545752.1.62754 gi|319899972|ref|YP_004159700.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]