SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900003|ref|YP_004159731.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900003|ref|YP_004159731.1|
Domain Number 1 Region: 210-443
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000000157
Family Soluble quinoprotein glucose dehydrogenase 0.036
Further Details:      
 
Domain Number 2 Region: 460-564
Classification Level Classification E-value
Superfamily CalX-like 0.00000000811
Family CalX-beta domain 0.0067
Further Details:      
 
Domain Number 3 Region: 602-690
Classification Level Classification E-value
Superfamily CalX-like 0.0000262
Family CalX-beta domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319900003|ref|YP_004159731.1|
Sequence length 820
Comment outer membrane protein [Bacteroides helcogenes P 36-108]
Sequence
MKKTRIHRVWLLLLLITMICSQVRAQYMPVVFDKKYGDKNQIQQICPLSGDEVAMIGKEG
QKYNLTWVGREGEVVFSLPLIGFTKVNEVTGLDNDCILIVGQSAVQNTKNRKDRVTLSGR
AIIVNRSGQLVNNIYAGAQGSDFLKGALLRSGSLLLSGTEPKGTSERQGILLKTDKSGKV
IYQYKNVDSGYCDQFAVLGNTTEYVCAAFSGDRDKEQTVVVRLDDKGKPYYMTVIPAKKY
TVTGLSANINDGSVIIIGNSQLEGGIIYKIRPEGDIVFGKTLIPANDGNASLKHLLVARN
GNVLVGGSGTKGYYALLRNDGTALYSGSSNGSVRGVGMNQNTGESVVTTYDMNTRRGTFV
RIQPTGKAEFDRTVEGNFDKIKVTNNGEVLLLSSDEGRVCMYSAAGEKEFDRYVTDNKPT
VFRQALTAASGELLFLGNGSRLVKLGHGLYVSDLKITKPVNGTATAVFTVTLTGYSTTKE
GAPIPVNVGYATREVSATTANNFTPVKGKLSFTPSRGTADRYLVKQEIEVPVKANDLIEG
VKTFELLLSDVQQSYLVKPVGKALIEDQQAVVKLVRTERGEEGAKDILYELGLFKTDGTA
LTNATGANIIVDGTYGEGTADALDFDMGLTPRVVFANGSRKSSFSVKTLEDTRYELPKTV
VVNFNKVHSLSGSNVSFDGELLSCSGIVADQPARLAITSLGDHRVNNNVVSGFFTVSLLR
ASDGALLTNATGSDIIVNCVALPDATAKEGKDFVFTNLHDLRISGDGNHSSANVNGVVLY
SMDNAEKQVKLKIKSVNQPIGAQPISVSAEESTAEFTIRK
Download sequence
Identical sequences E6SSH3
WP_013545783.1.62754 gi|319900003|ref|YP_004159731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]