SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900038|ref|YP_004159766.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900038|ref|YP_004159766.1|
Domain Number 1 Region: 115-462
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.23e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000464
Further Details:      
 
Domain Number 2 Region: 6-103
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-16
Family Anticodon-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319900038|ref|YP_004159766.1|
Sequence length 467
Comment asparaginyl-tRNA synthetase [Bacteroides helcogenes P 36-108]
Sequence
MEKISRTKIIDLLKREDFGAMVNVKGWVRTRRGSKQVNFIALNDGSTINNVQIVVDLDSF
EENMLKDITTGACLSVNGVLTESVGSGQKAEVHARAIEVLGACDNAYPLQKKGHSMEFLR
EIAHLRPRTNTFGAVFRIRHNMAMAIHHFFHERGFFYFHTPIITASDCEGAGQMFQVTTK
NLYDLKKDENGSIIYDDDFFGKQASLTVSGQLEGELAATALGAIYTFGPTFRAENSNTPR
HLAEFWMIEPEVAFNDIVDNMDLAEEFIKYCVQWALDNCADDVKFLNDMFDKGLIERLQG
VLKEKFVRLPYTEGIRILEDAVSKGHKFEFPVYWGVDLASEHERYLVEEHFKRPVILTDY
PKEIKAFYMKQNEDGKTVRAMDVLFPKIGEIIGGSEREADYDKLVTRIEELHIPMKDMWW
YLDTRKFGTCPHSGFGLGFERLLLFVTGMTNIRDVIPFPRTPRNAEF
Download sequence
Identical sequences E6SSK8
gi|319900038|ref|YP_004159766.1| WP_013545818.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]