SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900126|ref|YP_004159854.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900126|ref|YP_004159854.1|
Domain Number 1 Region: 5-41,75-397
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.02e-109
Family NagZ-like 0.000000772
Further Details:      
 
Domain Number 2 Region: 398-633
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 3.01e-49
Family Beta-D-glucan exohydrolase, C-terminal domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319900126|ref|YP_004159854.1|
Sequence length 750
Comment glycoside hydrolase 3 [Bacteroides helcogenes P 36-108]
Sequence
MKNKLIYKDSAAPVKDRVEDLLGRMTPEEKVGQMNQFVGLEHIRANSAVMTEAELRNNTA
NAFYPGVTDMDVAAWIEQGLIGSFLHVLTLKEANYLQSLAMKSRLQIPLIFGIDAIHGNA
NAPDNTVYPTNINLACSFDTLMAYRIARETAREMRAMNMHWTFNPNVEVARDARWGRVGE
TYGEDPYLAALMGAQSVRGYQGSLNSSEDVLACIKHFVGGSEPVNGTNGSPADLSERTLR
EVFFPPFEAGVRAGAMSLMMAHNELNGVPCHSNKWLMTDVLRGEWEFPGFVVSDWMDIEH
TYDLHATAENLKEAFYHSIMSGVDMHMHGIHWNEMVVELVKEGRIPQARIDESVRRILGV
KFRLGLFEQPYADEAETMKIRLCGEHRATALEAARDGIVLLKNEGVLPLDASRYKRVLVT
GINADDQNILGDWSALQKEDNVVTILDGLKMVAPPDTLFDFVDQGWNPRHMTPAKVDEAA
TRALSADLNIVVAGEYMMRFRWNDRTDGEDTDRSDLDLVGLQEELIRKVAASGKPTVLVL
VGGRPLSIRWAARHLPAIVEAWAPGMQGGRAVAEILYGKVNPSAKLAVTIPHSVGQLQMI
YNHKPSQYFHPYAAGRPSTPLYPFGYGLSYTTYRYDDLQLSRTEIGVDGSVDVSVQVTNT
GGRDGVEIVQLYIRDRFSCVTRPVKELKDFARVPLKAGESKVVNFRITSDKLAFYDISMK
KIVEPGEFIVMVGASSDDKDLLKSSFRVME
Download sequence
Identical sequences E6STR5
WP_013545885.1.62754 gi|319900126|ref|YP_004159854.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]