SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900133|ref|YP_004159861.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900133|ref|YP_004159861.1|
Domain Number 1 Region: 518-634,703-913
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.88e-72
Family beta-Lactamase/D-ala carboxypeptidase 0.0038
Further Details:      
 
Domain Number 2 Region: 38-304
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.12e-36
Family NagZ-like 0.0014
Further Details:      
 
Weak hits

Sequence:  gi|319900133|ref|YP_004159861.1|
Domain Number - Region: 335-496
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 0.000379
Family Beta-D-glucan exohydrolase, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319900133|ref|YP_004159861.1|
Sequence length 937
Comment beta-lactamase [Bacteroides helcogenes P 36-108]
Sequence
MKKYTFFLWITGLLLVSPLIHVQAYPSLLPSASDDRGCQWADSVLSRMSMQEKIGQLIVA
TIPAKADKENKKQIQELIRKYKVGGLLFAEGTPEEQAILTNMAQKAATVPVMVAFDGEQG
LSAWLKGVPDYPRNAALGCIEDDSLIEEYGRERARQFRELGININLIPVAGVNADPLIYV
HPFGENSGSAARKAEAYERGLVSGGIMVGYSSFLSPAVGEKRKEESASGELTFANVQEMK
GVSNAARITAKALLAGNDMLLTRFDTKNAVAGLMEAVRSGVLSSEMLDARCRKVLMCKYK
LGLAVWSGLRVSGMSYRINTERAQLLATRLRHSAVTLLNNYFDVLPLSPNCGSIALLSLG
DGGGDTSFGEAMKKHADVSNFCLSWNADETAREEVRRKLMAYRRIVISVTGSAYISDKDV
KFLNELELQAPLVYAFFTPYRTLLSLLPALSKASAVVLAHSAEAGLQQYVADVLFAKASA
VGKTSMSIGRTFPAGTGCDIVPGMKPGIAVPEDYGMKSYILHGIDNIACSGVAAGAYPGC
RIMILKDGHTVYDKGFGTHSDKDTTTVRPDDLFDLASLTKTTATLLAVMKLYDEGKLKLE
DKVSEFLPFLRGGNKKDITIRELLLHESGLPPYLRFYVDAIDPNSVHGPYSQSWIDEWHR
TQVSEHSYYCSDFKFRKGLMSDKPSAVYSLHVADGMWLNKDFKNTILQRIARCELDGKRY
VYSDLGFVLLQQVVEAIVQLPMDLYLAREFYAPMGLQRTMFLPLRRFSKEEIMPTASNDF
LRRQDLCGYVHDETAACMGGISGNAGLFSTADEVAKVYQMLLNGGELNGKRFLSEATCRL
FTTERSSVSRRGLGFDRPDVSAVQYSPCAASASAGVYGHTGFTGTCVWVDPENKTVYVFL
SNHLCPNVWSTKLGDMNIRTDIQELIFKSCTENRGLN
Download sequence
Identical sequences E6STS2
gi|319900133|ref|YP_004159861.1| WP_013545892.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]