SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900281|ref|YP_004160009.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900281|ref|YP_004160009.1|
Domain Number 1 Region: 64-151
Classification Level Classification E-value
Superfamily HIT-like 0.00000227
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319900281|ref|YP_004160009.1|
Sequence length 811
Comment SpoIID/LytB domain protein [Bacteroides helcogenes P 36-108]
Sequence
MSPTIQEFFTEQLSSWKMAQDNYAALSGVRTKELNVCGIPYKVQFNPARIVSSGAKVDAR
SIKQRKCFLCPENLPPMQQGIPFGGHYQILVNPFPIFPRHLTIPETAHVPQRIAARFGHM
LDLAQALPDYTVFYNGPRCGASAPDHAHFQAGSRGFMPIEKDWRGQVADKIACYKNAVLW
HLDDAPRNTLVIQSPSKDAAEELFGIICRALPMMPGQEEPMMNLLAAHEAGQWTVFVFAR
AKHRPACYAAEGDANLLSSPASVDLGGVFILPVEKDFVKITAEDIAGILGEVCLSAAESA
QLRQRIRQQIQTLATSPQDSRAKDNTAKGGGMENRRAEEPEVRVGIMSGTRIEFSFPTPY
RLHKHCREDASSTPILPEEVQAVTSGNGKVLWNNREFDELEFSPADESTGCFELRNVTIG
INFHWERQENQRFRGSLKFIAEDGKLTAVNVIRVEDYLTSVISSEMSATASLELLKAHAV
ISRSWLLAQIQKDKETAHAQTACPTPSQSGEEFIRWYDREDHTRFDVCADDHCQRYQGIT
RASTEIVKQAIAATRGQVLTYGGKICDARFSKCCGGAFEEFQYCWEDVKHPYLLKQRDFR
LPHSQAAGSAAEAASPCNDLPDLTQEAEAARWIRTSPQAFCNTADKQILAQVLNNYDRET
TDFYRWRVEYTQEELSALILKRSGIDYGQIIDLVPMARGTSGRLWKLKIVGTKKTLVIGK
ELEIRRILSASHLYSSAFVTDKEGSLPIDKDAPQGCGVQTVPARFILTGAGWGHGVGLCQ
IGAAVMGERGYKYDAILLHYYVGASIDRLYE
Download sequence
Identical sequences E6SUY7
gi|319900281|ref|YP_004160009.1| WP_013546040.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]