SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900283|ref|YP_004160011.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|319900283|ref|YP_004160011.1|
Domain Number - Region: 41-129
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 0.0426
Family Succinyl-CoA synthetase domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319900283|ref|YP_004160011.1|
Sequence length 413
Comment hypothetical protein Bache_0398 [Bacteroides helcogenes P 36-108]
Sequence
MKKTITICLLCLLCGSALQAQKIKVKTGIEVLKEQNFRCLEGKRVGLITNPTGVDNRMKS
TIDILHEAPNVNLVALYGPEHGVRGDVHAGDHVADMKDASTGLPVHSLYGKTRKATPQML
KDVDVLVYDIQDIGCRSFTYISTMGLAMEAAAENGKEFIVLDRPNPVGGLKIEGNLTEDD
CISFVSQFKIPYLYGLTCGELALMLNGERMLKEGRQCNLHVVKMKGWKRKMDYTQTGLQW
VPSSPHIPHPHSAFFYPVSGILGELGYMSIGVGYTIPFQMFAAPWMEAEKLAGRLNSLHV
PGVVFRPMYLKPFYSVGKGELLQGVQVHITDFGKAPLSELQFLVMQEAAALYPDRAVFDH
ADKGRFPMFDKVCGSRQIRERFSKRNRWEDIRDYWYKDAEDFRRLSKKHYLYR
Download sequence
Identical sequences E6SUY9
WP_013546042.1.62754 gi|319900283|ref|YP_004160011.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]