SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900331|ref|YP_004160059.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900331|ref|YP_004160059.1|
Domain Number 1 Region: 28-356
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.16e-84
Family NagZ-like 0.00016
Further Details:      
 
Domain Number 2 Region: 358-426,460-576,612-634
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 9.42e-42
Family Beta-D-glucan exohydrolase, C-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319900331|ref|YP_004160059.1|
Sequence length 765
Comment beta-glucosidase [Bacteroides helcogenes P 36-108]
Sequence
MKSLAAGIGIFLCCAPLPAQELKLRADNIDEIVKAMTPEEKALLVVGRNDYTFGGYDNPK
EFVRFLSPSVSGYTQGIPRLGIPPTALADGPAGAVVVTRPDNKKSYYATGFPVGTSLACS
WNTQLVESVGRAMGNEILEYGVDVILAPGMNIHRSPLCGRNYEYYSEDPVVTGKIAAAFV
RGIQGCGVGTSIKHFAVNSQETNRTEVDEIVSQRALREIYLKGFEIAVKEARPWTVMASY
NRLNGPYTQESPELLTTVLRDEWGFDGIVMTDWIQKRNTAAQIKAGIDNLQPGYQVQLQD
ISLMLKDGRLTMPDLDASVRRMLQYIVKTPHFRNYKYSDDPDLKAHAAITRSSATEGMVL
LKNAGGVLPLNNIKKVALFGLSSFDFMAGGTGSGNVVKPYVVDLQQGLANAGLEVTGNLK
EMYTAYKTFCRAQFKCDRNPAERWYVEPSIPELSLSRTCIENQARESDIAILTLGRQAGE
GRDRPVKGGFNLTAVEQNLLVELCEVYHAAGKKVIVVLNVGGAIETASWKGLPDAILLAW
QPGQEGGNSVADVLLGKENPSGKLSMTFPISVMDMPSSQNFPLGDERRRGEDGSRNNVDY
TLHKEGINIGYRYFSSVGREVSYPFGFGLSYTAFAYSKPVVKPVADGFCAGITVTNTGKC
AGKESVQLYVSAPAGGMEKPALELKAFAKTRLLQPGESETLTFEVSKYSLASFDESRQSW
VSAAGRYIVRFGASVDDIRGTGYYNLAKEAAWRVHDVLKPTKALD
Download sequence
Identical sequences E6SVG3
gi|319900331|ref|YP_004160059.1| WP_013546089.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]