SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900405|ref|YP_004160133.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900405|ref|YP_004160133.1|
Domain Number 1 Region: 26-417
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.9e-103
Family NagZ-like 0.000000983
Further Details:      
 
Domain Number 2 Region: 418-660
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 6.54e-52
Family Beta-D-glucan exohydrolase, C-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319900405|ref|YP_004160133.1|
Sequence length 780
Comment glycoside hydrolase 3 [Bacteroides helcogenes P 36-108]
Sequence
MNKKLILSLALSGLVLTTAAQTKVTPAIPQDAKMEQQIEKLLKKMTLDEKVGQMCELTID
LLQDRKANPSNGFRLSEAMLDSVIGKYKVGSILNVPNGIAQTPAKWQEIIKRIQEKSIKE
IGIPCVYGVDQIHGTTYTLGGTFFPQGINMGAAFNRELTRRGAEISAYETKAGSIPWTYA
PVTDLGRDPRWPRQWENYGEDCYLNAEMGREAVIGFQGNDPNHIGTRNVAACMKHFMGYG
APVSGKDRTPSSITVQDMREKHFAPYLEMVRNGALSVMVNSAMNNGLPFHANYELLTKWL
KEDLEWDGMIVTDWADIDNLWKRDHIAKDKKEAIKLAINAGIDMSMDPYDWRFCPLLKEL
VQEGEVPMSRIDDAVRRVLRLKYRLNLFEKPYYDLKDFPLFGGKQHAAAALQAAEESLVL
LKNTDAVLPLAKGKKILLTGPNANSMRCLNGGWSYTWQGSNAEACAEPYNTILEAFTNKF
GADHVIYEAGVTYNDKGNWWEENTPQIEKAVAAAAKADYIVACIGENSYCETPGNLTNLF
LSENQLDLVKALAKTGKPVILILSEGRPRIISDIEPLAKAVVDVMLPGNYGGDALANLIA
GDANFSGKLPFTYPKEINSLITYDYKPCEHIGKQMEGAYNYDAQVSVQWAFGYGLSYTTF
AYSNLKVNKPNFSANDELIFTVDVKNTGNCIGKESVLLFSSDLIASLTPDNRRLRAFEKV
ELNPGESKTVTLKLKASDLAFVGYDGKWILEKGDFRIQAGSQVMNVVCTDTKKWETPNKQ
Download sequence
Identical sequences E6SW22
gi|319900405|ref|YP_004160133.1| WP_013546163.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]