SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900544|ref|YP_004160272.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900544|ref|YP_004160272.1|
Domain Number 1 Region: 547-952
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6e-157
Family DNA polymerase I 0.00000000285
Further Details:      
 
Domain Number 2 Region: 5-156
Classification Level Classification E-value
Superfamily PIN domain-like 1.15e-48
Family 5' to 3' exonuclease catalytic domain 0.0000836
Further Details:      
 
Domain Number 3 Region: 363-542
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.33e-46
Family DnaQ-like 3'-5' exonuclease 0.0000264
Further Details:      
 
Domain Number 4 Region: 178-288
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 4.19e-32
Family 5' to 3' exonuclease, C-terminal subdomain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319900544|ref|YP_004160272.1|
Sequence length 952
Comment DNA polymerase I [Bacteroides helcogenes P 36-108]
Sequence
MNSTDKLFLLDAYALIYRAYYAFIKNPRINSKGFNTSAILGFVNTLEEVLKKENPSHIGV
AFDPSGPTFRHEAYEQYKAQREETPEAIRLSVPIIKDIIRAYRIPILEVPGYEADDVIGT
LATEAGKRGITTYMMTPDKDYGQLVADNVFMYRPKHTGGFEVMGVEEVKAKFDIRSTAQV
IDMLGLMGDASDNIPGCPGVGEKTAQKLIAEFGSIENLLEHTDRLKGALKIKVENNREMI
TFSKFLATIKVDVPITLDMKALVREEANEDELRKIFEELEFRTLLDRVLKKGNSPLPSSS
TPSASPDLYAGTLFAAQPKTNADEKSGPVQGNLFANFADDGADSSKNSNLTRLELLDTDY
QLIDTEKKRKDFIQKLITSEILSIDTETTGTEPMEAELVGMSFSDAENQAYYVPVPPIRE
EALKIVNELRPLYENEKSLKVGQNIKYDMIVLQNYEIQVKGPLFDTMLAHYVLQPELRHN
MDYLAEIYLHYQTIHIDELIGPRGKNQKNMRDLSPEEVYRYACEDADVTLKLKNILEKEL
KEQGGEHLFHEIEMPLVPVLVNIESNGVRLDTEALKQSSEHFTIRLQEIEKEIYALADET
FNIASPKQVGEILFDKLRIVEKAKKTKTGQYVTSEEVLESLRGKHGIIGKILEYRGLKKL
LSTYIDSLPQLINPRTGHIHTSFNQAVTATGRLSSSNPNLQNIPIRDEDGKEIRKAFIPD
DGCEFFSADYSQIELRIMAHLSEDRNMIDAFRSGYDIHAATAAKIYKTDISDVTADMRRK
AKTANFGIIYGISVFGLAERMNVSRQEAKELIDGYFETYPQVKEYMDRSIRIARENGYVE
TIFHRKRFLPDINSRNAVVRGYAERNAINAPIQGSAADIIKVAMAHIHRRFVSNNLKAKM
ILQVHDELNFSVPASEKEIVQKIVIEEMEHAYSMHVPLKADCGWGKNWLEAH
Download sequence
Identical sequences E6SMX0
gi|319900544|ref|YP_004160272.1| WP_013546301.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]