SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900560|ref|YP_004160288.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900560|ref|YP_004160288.1|
Domain Number 1 Region: 268-566
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.09e-84
Family DNA repair protein MutS, domain III 0.0000012
Further Details:      
 
Domain Number 2 Region: 567-802
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.95e-57
Family ABC transporter ATPase domain-like 0.00000115
Further Details:      
 
Domain Number 3 Region: 7-113
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 3.79e-39
Family DNA repair protein MutS, domain I 0.0000453
Further Details:      
 
Domain Number 4 Region: 114-267
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 6.93e-38
Family DNA repair protein MutS, domain II 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319900560|ref|YP_004160288.1|
Sequence length 872
Comment DNA mismatch repair protein MutS [Bacteroides helcogenes P 36-108]
Sequence
MNEDIVLTPMMKQFLDLKAKHPDAVMLFRCGDFYETYSTDAIVASEILGITLTKRANGKG
KTVEMAGFPHHALDTYLPKLIRAGKRVAICDQLEDPKLTKKLVKRGITELVTPGVSINDN
VLNYRENNFLAAVHFGKGTCGVAFLDISTGEFLTAEGPFDYVDKLLNNFAPKEVLFERGK
RLMFEGNFGNKFFTFELDDWVFTETTAREKLLKHFEVKNLKGFGVEHLKNGIIASGAILQ
YLIMTQHTQIGHITSLARIEEDKYVRLDKFTVRSLELMGSMNDGGSSLLNVIDKTISPMG
ARLLKRWLVFPLKDVQPINERLNVVEYFFRQPDFKELIEEQLHLIGDLERIISKVAVGRV
SPREVVALKVALQAIEPIKEACVQADNASLNHIGEQLNICRSIRDRIDKEIDNDPPLLIN
KGGVIKSGVSAELDELRRIAYSGKDYLLQVQQRESELTGIPSLKIGYNNVFGYYIEVRNV
HKEKVPQEWIRKQTLVNAERYITQELKEYEEKILGAEDKILVLETQLYTELVQALSEFIP
AIQIDANQIARLDCLLSFATAARENNYIRPVISDDEVLEIHQGRHPVIEKQLPIGEKYIA
NDVMLDSTTQQIIIITGPNMAGKSALLRQTALITLLAQIGSFVPAESAHIGLVDKIFTRV
GASDNISVGESTFMVEMNEAADILNNLSPRSLVLFDELGRGTSTYDGISIAWAIVEHIHE
HPKAKARTLFATHYHELNEMEKSFKRIKNYNVSVKEVDNKVIFLRKLERGGSEHSFGIHV
AKLAGMPKSIVKRADEILHQLEAENRQTGMVSGKTITEGASSAGGMQLSFFQLDDPVLCQ
IRDEILNLDVNNLTPLEALNKLNDIKRIVKGK
Download sequence
Identical sequences E6SMY6
WP_013546317.1.62754 gi|319900560|ref|YP_004160288.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]