SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|319900594|ref|YP_004160322.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900594|ref|YP_004160322.1|
Domain Number 1 Region: 6-146
Classification Level Classification E-value
Superfamily Ferritin-like 1.08e-38
Family Ferritin 0.0000194
Further Details:      
 
Domain Number 2 Region: 151-191
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00000000000888
Family Rubredoxin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319900594|ref|YP_004160322.1|
Sequence length 192
Comment Rubrerythrin [Bacteroides helcogenes P 36-108]
Sequence
MAKSIKGTQTEKNLLTSFAGESQARMRYTYFASVAKKEGYEQIAAIFTETADQEKEHAKR
MFKCLEGGPVEITATYPAGIIGTTLENLQAAAEGEHEEWSLDYPHFADVAEQEGFQAIAA
MYRNIAIAEKGHEERYRAFVKNIETASVFAKEGEVVWQCRNCGFIYTGKEAPQVCPACLH
PQAYFEVKKENY
Download sequence
Identical sequences E6SNE3
WP_013546351.1.62754 gi|319900594|ref|YP_004160322.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]