SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900672|ref|YP_004160400.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900672|ref|YP_004160400.1|
Domain Number 1 Region: 190-499,537-634
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.71e-135
Family RNB domain-like 0.00000171
Further Details:      
 
Domain Number 2 Region: 636-716
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.23e-19
Family Cold shock DNA-binding domain-like 0.0061
Further Details:      
 
Domain Number 3 Region: 96-218
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000589
Family Cold shock DNA-binding domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319900672|ref|YP_004160400.1|
Sequence length 717
Comment RNAse R [Bacteroides helcogenes P 36-108]
Sequence
MAKTKEKKEKKAGKRMKKKELVKVLLDFFHTKQDEVLSLKYIFEQLRLTTHPLKMLCMDI
LSELSDDDYITEVDKHKYKLNCHGTEMTGTFQRKSNGKNSFIPEGGGDPIFVAERNSAHA
MNNDKVRIAFYAKRRGREAEGEVTEILERANDTFVGTLEVAESYAFLVTENRTLANDIFI
PKEKLKGGKTGDKAIVKVVEWPDKAKNPIGQVIDILGRTGDNTTEMHAILAEFGLPYVYP
SAVENAADKISDEIPAEEIAKREDFRSVTTFTIDPKDAKDFDDALSIRKLKEGLWEVGVH
IADVTHYVKEGGIIDKEAEKRATSVYLVDRTIPMLPERLCNFICSLRPDEEKLAYSVIFE
MTEKGEVNNSRVVHTVIKSNRRFTYEEAQNIIETRKGDFKEEVLQLDRLAKLLRESRFKA
GAINFDRYEVKFEIDEKGKPVSVYFKESKDANKLVEEFMLLANRTVAEKIGRVPKGKKAK
VLPYRIHDLPDPEKLDNLAQFIARFGYKLRTGGTKTDVSKSINHLLDDIQGKKEENLIET
VSIRAMQKARYSVHNVGHYGLAFDYYTHFTSPIRRYPDMMVHRLLTKYLDLGGRSVSEQK
YEALCEHSSSMEQIAANAERASIKYKQVEFMTEHLGQTYDGVISGVTEWGLYVELNENKC
EGMIPIRDLDDDYYEFDEKNYCLRGRRKNRIYSLGDGITIKVARANLEKKQLDFALV
Download sequence
Identical sequences E6SNZ6
WP_013546429.1.62754 gi|319900672|ref|YP_004160400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]