SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900729|ref|YP_004160457.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900729|ref|YP_004160457.1|
Domain Number 1 Region: 2-230
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.86e-64
Family Sir2 family of transcriptional regulators 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319900729|ref|YP_004160457.1|
Sequence length 232
Comment Silent information regulator protein Sir2 [Bacteroides helcogenes P 36-108]
Sequence
MKNLVVLSGAGMSAESGISTFRDAGGLWDRYPVEQVATPEGYARDPELVINFYNERRRQL
LDVKPNAGHAGLAELERDFNVTVVTQNVDNLHERAGSTHVIHLHGELTKVCSSRDPYNPH
FIKELKPGEYEVKMGDKAGDGTQLRPFIVWFGEAVPQIETAIRYVEKADIFVIIGTSMNV
YPAAGLLNYVPREADVYLIDPKPVDAHTLRQIHVIRKGASDGVEELISLLRS
Download sequence
Identical sequences E6SPI2
gi|319900729|ref|YP_004160457.1| WP_013546484.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]