SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900739|ref|YP_004160467.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900739|ref|YP_004160467.1|
Domain Number 1 Region: 7-142,177-385
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.07e-93
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000922
Further Details:      
 
Domain Number 2 Region: 390-592
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 9.35e-43
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000156
Further Details:      
 
Domain Number 3 Region: 573-679
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.69e-24
Family Myf domain 0.00026
Further Details:      
 
Domain Number 4 Region: 143-177
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00000000000615
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319900739|ref|YP_004160467.1|
Sequence length 680
Comment methionyl-tRNA synthetase [Bacteroides helcogenes P 36-108]
Sequence
MEKKFKRTTVTSALPYANGPVHIGHLAGVYVPADIYVRYLRLKKEEVVFIGGSDEHGVPI
TIRAKKEGVTPQDVVDRYHTLIKKSFEDFGISFDVYSRTSSKTHHDTASDFFRKLYEKGE
FIEKTSMQYYDEEAKQFLADRYITGECPHCHSEGAYGDQCEKCGTSLSPTDLINPKSAIS
GSKPVMRETKHWYLPLDKHENWLRRWILEEHKEWRPNVYGQCKSWLDMGLQPRAVSRDLD
WGIPVPVEGAEGKVLYVWFDAPIGYISNTKELLPESWEKWWKDPETRLVHFIGKDNIVFH
CIVFPAMLKAEGSYILPDNVPSNEFLNLEGDKISTSRNWAVWLHEYLQDFPGKQDVLRYV
LTANAPETKDNDFTWKDFQARNNNELVAVYGNFVNRALQLTKKYFDGVVPAAAGLTDYDR
ETLKEFSDVKAEVEKLLDVFKFRDAQKEAMNLARIGNKYLADTEPWKLAKTDMERVATIL
NIALQLVANLAIAFEPFLPFSSDKLRKMLNMDSFDWAELGHTDLLPAGHRLGTPDLLFEK
IEDDTIQAQVDKLLATKKANEAANYKASPIKPTVSFEEFEKLDIRVGTVLECSVVPKMKK
LLQFKIADGLENRTIVSGIAQHYQPEELVGKQVLFIANLAPRQFKNGLVSEGMILSAENY
DGALAVTSLLREVKPGSEVK
Download sequence
Identical sequences E6SPJ2
WP_013546494.1.62754 gi|319900739|ref|YP_004160467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]