SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900747|ref|YP_004160475.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900747|ref|YP_004160475.1|
Domain Number 1 Region: 487-685
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.45e-33
Family BC ATP-binding domain-like 0.093
Further Details:      
 
Domain Number 2 Region: 3-139
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.55e-27
Family CoA-binding domain 0.00027
Further Details:      
 
Domain Number 3 Region: 133-289
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 2.35e-25
Family Succinyl-CoA synthetase domains 0.00026
Further Details:      
 
Domain Number 4 Region: 300-451
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 6.93e-20
Family Succinyl-CoA synthetase domains 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319900747|ref|YP_004160475.1|
Sequence length 687
Comment CoA-binding domain protein [Bacteroides helcogenes P 36-108]
Sequence
MITSQLLQPASIVVVGASNNAHKPGGAILRNLINGKYTGELRAVNPKETEVQGVTAFADV
KDIPDTDLAILAIPAALCPDAVEVLAAEKRVRAFIILSAGFGEETHEGALLENRILETVN
RYGASLIGPNCIGLLNTWHHSVFSQPIPNLNPQGVDLISSSGATAVFILESAVTKGLQFN
SVWSVGNAKQIGVEDVLQYMDENFNPETDSKIKLLYIESIGDPDRLLLHASSLIRKGCRI
AAIKAGSSESGSRAASSHTGAIASSDSAVEALFRKAGIVRCYSREELTTVGCIFTLPELK
GRNFAIITHAGGPGVMLTDALSKGGLNVPKLEGALAEELKGKLFPGAAVGNPIDILATGT
PEHLRLCLEYCEEKLDEIDAVMAIFGTPGLVTMFEMYDVLHEKMLTCTKPIFPILPSINT
AGAEVAAFLAKGHVNFADEVTLGTALSRIVNASSPANNEIELFGVDVPRIRRIIDSIPED
GYIEPHYVQALLHSAGIPVVEEFVSANREEVLAFARRAGYPVVAKVVGPVHKSDVGGVVL
NIKGDQHLALEFDRMMQIPEVTGIMVQPMLEGTELFIGAKYEEKFGHVVLCGLGGIFVEV
LKDVSSGLAPLSYEEAYSMIHSLRAYKIIKGTRGQKGVNEDKFAEIIVRLSTLLRFATEI
KEMDINPLLATEKEVIAVDARIRIEKD
Download sequence
Identical sequences E6SPK0
WP_013546502.1.62754 gi|319900747|ref|YP_004160475.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]