SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900855|ref|YP_004160583.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900855|ref|YP_004160583.1|
Domain Number 1 Region: 298-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-47
Family Ribonuclease PH domain 1-like 0.0000893
Further Details:      
 
Domain Number 2 Region: 12-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-44
Family Ribonuclease PH domain 1-like 0.0001
Further Details:      
 
Domain Number 3 Region: 146-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.22e-26
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 452-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.69e-26
Family Ribonuclease PH domain 2-like 0.00015
Further Details:      
 
Domain Number 5 Region: 615-703
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.57e-20
Family Cold shock DNA-binding domain-like 0.00088
Further Details:      
 
Domain Number 6 Region: 556-636
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000179
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 7 Region: 241-325
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000863
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319900855|ref|YP_004160583.1|
Sequence length 735
Comment polyribonucleotide nucleotidyltransferase [Bacteroides helcogenes P 36-108]
Sequence
MINPIVKTIELPDGRTITLETGKLAKQADGSVMLRMGNTMLLATVCAAKDAVPGTDFMPL
QVEYKEKFSAFGRFPGGFTKREGRASDYEILTCRLVDRALRPLFPDNYHAEVYVNIILFS
ADGVDMPDALAGLAASAALAVSDIPFNGPISEVRVARIDNQFVINPTFEQLEKADMDLMV
GATYENIMMVEGEMSEVSEQDLLEAMKAAHEAIKIQCKAQMELAEEVGSTVKREYCHEVN
DEELRKAVHDACYAKAYAIAASGNKNKHERMDAFDAICEEFKAQFSEEELAEKAALIDRY
YHDVEKEAMRRSILDEGKRLDGRKTTEIRPIWCETSYLPGPHGSAIFTRGETQSLSTVTL
GTKLDEKIIDDVLEHGKERFLLHYNFPPFSTGEAKAQRGVGRREIGHGHLAWRALKGQIP
ADYPYVVRVVSDILESNGSSSMATVCAGTLALMDAGVKIKKPVSGIAMGLIKNAGEAKYA
VLSDILGDEDHLGDMDFKVTGTKDGITATQMDIKCDGLTYDILEKALLQAKEGREFILGK
ITECIAEPREDLKPHAPRIETMTIPKEFIGAIIGPGGKIIQGMQEETGATITIEEIDNVG
RIEIAGTNKQCIDDAMRMIKGIVAVPEVGEVYKGKVRSIMPYGAFVEFLPGKDGLLHISE
IDWKRLETVEEAGIKEGDEIEVKLLEVDPKTGKFKLSRKVLLPKPEGYVERPERGERRDR
NDRGGERRERRDRND
Download sequence
Identical sequences E6SQM3
gi|319900855|ref|YP_004160583.1| WP_013546610.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]