SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900858|ref|YP_004160586.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900858|ref|YP_004160586.1|
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily HIT-like 1.14e-34
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319900858|ref|YP_004160586.1|
Sequence length 130
Comment histidine triad (HIT) protein [Bacteroides helcogenes P 36-108]
Sequence
MATIFSRIIAGEIPCYKVAEDDKFFAFLDINPLVKGHTLVVPKQEVDYIFDLEDEDLAAM
HVFAKRVAVAIGKAFPCKKVGEAVLGLEVPHAHIHLIPMQSEKDMLFSNPKLKLTDGEFK
VVVEAIRAML
Download sequence
Identical sequences E6SQM6
gi|319900858|ref|YP_004160586.1| WP_013546613.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]