SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900920|ref|YP_004160648.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900920|ref|YP_004160648.1|
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-53
Family Cold shock DNA-binding domain-like 0.00000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319900920|ref|YP_004160648.1|
Sequence length 133
Comment 30S ribosomal protein S12P [Bacteroides helcogenes P 36-108]
Sequence
MPTIQQLVRKGREVLVEKSKSPALDSCPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTNG
KEVNSYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVAGRTQRRSKYGAK
RPKPGQAAPAKKK
Download sequence
Identical sequences A0A139JX89 A0A174DPG8 A0A285TCR6 A7UZT5 D2EW28 E5V5N1 E6SRB8 F3PSY8 I8ZG28 R9I5V6
gi|319900920|ref|YP_004160648.1| WP_005825712.1.17938 WP_005825712.1.33309 WP_005825712.1.38405 WP_005825712.1.4051 WP_005825712.1.40743 WP_005825712.1.57299 WP_005825712.1.57939 WP_005825712.1.57999 WP_005825712.1.5868 WP_005825712.1.61830 WP_005825712.1.61928 WP_005825712.1.62754 WP_005825712.1.69811 WP_005825712.1.73306 WP_005825712.1.78756 WP_005825712.1.79035 WP_005825712.1.87028 WP_005825712.1.87442 WP_005825712.1.90191 WP_005825712.1.92549 WP_005825712.1.96419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]