SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900925|ref|YP_004160653.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900925|ref|YP_004160653.1|
Domain Number 1 Region: 1-207
Classification Level Classification E-value
Superfamily Ribosomal protein L4 2.35e-71
Family Ribosomal protein L4 0.00000859
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319900925|ref|YP_004160653.1|
Sequence length 208
Comment 50S ribosomal protein L4P [Bacteroides helcogenes P 36-108]
Sequence
MEVNVYNIKGEDTGRKVTLNESIFGIEPNDHAIYLDVKQFMANQRQGTHKSKERSEISGS
TRKIGRQKGGGGARRGDMNSPVLVGGGRVFGPKPRDYYFKLNKKVKALARKSALSYKAQN
NAIVVVEDFTFATPKTKDFIEMTKNLKVSDKKLLVVLPEANKNVYLSARNVKSANVQAVS
GLNTYRVLDAGIIVLAESALSAIDNILM
Download sequence
Identical sequences E6SRC3
gi|319900925|ref|YP_004160653.1| WP_013546674.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]