SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900927|ref|YP_004160655.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900927|ref|YP_004160655.1|
Domain Number 1 Region: 126-271
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 9.03e-56
Family C-terminal domain of ribosomal protein L2 0.00000357
Further Details:      
 
Domain Number 2 Region: 2-122
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.11e-45
Family Cold shock DNA-binding domain-like 0.00000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319900927|ref|YP_004160655.1|
Sequence length 274
Comment 50S ribosomal protein L2P [Bacteroides helcogenes P 36-108]
Sequence
MAVRKFKPTTPGQRHKIIGTYEEITARVPEKSLVFGKKSSGGRNNTGKMTMRYIGGGSKK
IIRIIDFKRNKDGVPAVVKTIEYDPNRSARIALLFYVDGEKRYIIAPNGLQVGMTLMSGE
TAAPEIGNALPLQNIPVGTVIHNIELRPGQGAALVRSAGNFAQLTSREGKYCVIKLPSGE
VRQILSTCKATIGSVGNSDHGLESSGKAGRSRWFGRRPRNRGVVMNPVDHPMGGGEGRAS
GGHPRSRKGLYAKGLKTRAPKKQSSKYIIERRKK
Download sequence
Identical sequences E6SRC5
gi|319900927|ref|YP_004160655.1| WP_013546676.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]