SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900933|ref|YP_004160661.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900933|ref|YP_004160661.1|
Domain Number 1 Region: 7-84
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.57e-33
Family Cold shock DNA-binding domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319900933|ref|YP_004160661.1|
Sequence length 85
Comment 30S ribosomal protein S17P [Bacteroides helcogenes P 36-108]
Sequence
MEARNLRKERTGVVLSNKMDKTITVAAKFKEKHPIYGKFVSKTKKYHAHDEKNECNIGDT
VHIMETRPLSKTKRWRLVEIIERAK
Download sequence
Identical sequences A0A174N165 A0A1M6L0G1 A0A285TBE8 E5V5L8 E6SRD1 I8ZEP1 K9DX07 R9I5F8
WP_005833548.1.33309 WP_005833548.1.38405 WP_005833548.1.4051 WP_005833548.1.40743 WP_005833548.1.57299 WP_005833548.1.57939 WP_005833548.1.5868 WP_005833548.1.61928 WP_005833548.1.62754 WP_005833548.1.69811 WP_005833548.1.73306 WP_005833548.1.78756 WP_005833548.1.84564 WP_005833548.1.87442 WP_005833548.1.90191 WP_005833548.1.95267 WP_005833548.1.98544 gi|319900933|ref|YP_004160661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]