SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900946|ref|YP_004160674.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900946|ref|YP_004160674.1|
Domain Number 1 Region: 1-71
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.99e-28
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319900946|ref|YP_004160674.1|
Sequence length 72
Comment bacterial translation initiation factor 1 (bIF-1) [Bacteroides helcogenes P 36-108]
Sequence
MAKQSAIEQDGVIVEALSNAMFRVELENGHEITAHISGKMRMHYIKILPGDKVRVEMSPY
DLSKGRIVFRYK
Download sequence
Identical sequences A0A015SK76 A0A015TDW8 A0A015V334 A0A015YEG4 A0A076IUG0 A0A078PKE1 A0A078PXF0 A0A078RZK2 A0A081TN80 A0A0E2AIM3 A0A0E2AJM3 A0A0E2RI09 A0A0E2SQW8 A0A0J9IP43 A0A0M1W0D0 A0A0P0FJW1 A0A0P0FSV3 A0A108T9E4 A0A139JX96 A0A139L2T9 A0A139L5D8 A0A174DMR0 A0A174I1J4 A0A174I2X5 A0A174NWN8 A0A174Q5D2 A0A1C5X4N6 A0A1C7H2V9 A0A1E9CIX8 A0A1F0IJL6 A0A1G7PYA3 A0A1H3DEK6 A0A1H8Q255 A0A1M5D0F4 A0A1M6KZN6 A0A1Q6G3Z1 A0A1Q6G7U6 A0A1Y3YY95 A0A1Y4ALU8 A0A1Y4HJA9 A0A285TFK1 A5ZBJ3 A7LT65 A7UZQ8 B0NTB7 B3C894 B3JHJ1 B5CTP0 B6W5J7 B7AKF9 C3QB61 C3R0B0 C3R9N9 C6II52 C6Z0M8 C9KRG4 D0TLH4 D1JVY8 D1K408 D2EW02 D4VGX8 D4WIW5 D6CXM7 D7IF03 D7J7W0 D7JWX5 E1WP13 E2NEL0 E4W126 E5CI05 E5UPP9 E5V5K5 E5X0U8 E6SRY6 F3PJG7 F3PT14 F7LID0 F7LUW5 F7MC48 I8UXG7 I8UZR3 I8WZK4 I8ZU61 I9AEV7 I9B0F5 I9FP03 I9QZX5 I9SGM3 I9T4Z1 I9TWY9 K1FEV6 K1GAF9 K1GS45 K5CMQ2 K9DSD0 Q5L8D1 Q64NN0 Q8A498 R5IZJ2 R6C6U4 R6DIE1 R6FSS6 R9H3T7 R9H563 R9IDP2 R9IJT2 S0F4U5 S3ZMI9 U2DXD2 U6RDH0 U6RVS5 W4P407 W4PEP4 W4PRF6 W4UQ16
NP_811617.1.73244 WP_002558052.1.10024 WP_002558052.1.10040 WP_002558052.1.10083 WP_002558052.1.101046 WP_002558052.1.102052 WP_002558052.1.102092 WP_002558052.1.10223 WP_002558052.1.10405 WP_002558052.1.10487 WP_002558052.1.10665 WP_002558052.1.10687 WP_002558052.1.1104 WP_002558052.1.11110 WP_002558052.1.11335 WP_002558052.1.11913 WP_002558052.1.12058 WP_002558052.1.1249 WP_002558052.1.12560 WP_002558052.1.13359 WP_002558052.1.13775 WP_002558052.1.15557 WP_002558052.1.15823 WP_002558052.1.15915 WP_002558052.1.16618 WP_002558052.1.17467 WP_002558052.1.17516 WP_002558052.1.17530 WP_002558052.1.17938 WP_002558052.1.18028 WP_002558052.1.18195 WP_002558052.1.18542 WP_002558052.1.18967 WP_002558052.1.19130 WP_002558052.1.19523 WP_002558052.1.19590 WP_002558052.1.19864 WP_002558052.1.20075 WP_002558052.1.2011 WP_002558052.1.20211 WP_002558052.1.20771 WP_002558052.1.20923 WP_002558052.1.20997 WP_002558052.1.21107 WP_002558052.1.21574 WP_002558052.1.21713 WP_002558052.1.21908 WP_002558052.1.22050 WP_002558052.1.22866 WP_002558052.1.22894 WP_002558052.1.23698 WP_002558052.1.24025 WP_002558052.1.25291 WP_002558052.1.26154 WP_002558052.1.2625 WP_002558052.1.26260 WP_002558052.1.26832 WP_002558052.1.2685 WP_002558052.1.26934 WP_002558052.1.26971 WP_002558052.1.27571 WP_002558052.1.28290 WP_002558052.1.29459 WP_002558052.1.29471 WP_002558052.1.29995 WP_002558052.1.30158 WP_002558052.1.30608 WP_002558052.1.30930 WP_002558052.1.31445 WP_002558052.1.31541 WP_002558052.1.32410 WP_002558052.1.32651 WP_002558052.1.33107 WP_002558052.1.33241 WP_002558052.1.33309 WP_002558052.1.33337 WP_002558052.1.33364 WP_002558052.1.33644 WP_002558052.1.34002 WP_002558052.1.34613 WP_002558052.1.34664 WP_002558052.1.34692 WP_002558052.1.34924 WP_002558052.1.35533 WP_002558052.1.35714 WP_002558052.1.35818 WP_002558052.1.36210 WP_002558052.1.36284 WP_002558052.1.36345 WP_002558052.1.36583 WP_002558052.1.36984 WP_002558052.1.37052 WP_002558052.1.37869 WP_002558052.1.37910 WP_002558052.1.37988 WP_002558052.1.38405 WP_002558052.1.38746 WP_002558052.1.39319 WP_002558052.1.39634 WP_002558052.1.39779 WP_002558052.1.3999 WP_002558052.1.40326 WP_002558052.1.40404 WP_002558052.1.4051 WP_002558052.1.4066 WP_002558052.1.40743 WP_002558052.1.42362 WP_002558052.1.4322 WP_002558052.1.43461 WP_002558052.1.43770 WP_002558052.1.43857 WP_002558052.1.44254 WP_002558052.1.44367 WP_002558052.1.44936 WP_002558052.1.45558 WP_002558052.1.456 WP_002558052.1.46679 WP_002558052.1.46941 WP_002558052.1.47352 WP_002558052.1.47969 WP_002558052.1.4838 WP_002558052.1.48703 WP_002558052.1.49420 WP_002558052.1.49654 WP_002558052.1.49999 WP_002558052.1.50072 WP_002558052.1.50677 WP_002558052.1.50935 WP_002558052.1.51373 WP_002558052.1.5142 WP_002558052.1.51489 WP_002558052.1.51763 WP_002558052.1.52087 WP_002558052.1.52461 WP_002558052.1.52936 WP_002558052.1.53232 WP_002558052.1.53332 WP_002558052.1.53885 WP_002558052.1.53910 WP_002558052.1.53995 WP_002558052.1.54019 WP_002558052.1.54168 WP_002558052.1.54252 WP_002558052.1.54521 WP_002558052.1.54640 WP_002558052.1.55270 WP_002558052.1.56204 WP_002558052.1.56832 WP_002558052.1.57121 WP_002558052.1.57299 WP_002558052.1.57939 WP_002558052.1.57999 WP_002558052.1.58084 WP_002558052.1.58123 WP_002558052.1.5868 WP_002558052.1.5909 WP_002558052.1.59332 WP_002558052.1.59346 WP_002558052.1.59392 WP_002558052.1.59539 WP_002558052.1.6049 WP_002558052.1.60699 WP_002558052.1.60795 WP_002558052.1.60854 WP_002558052.1.610 WP_002558052.1.61603 WP_002558052.1.61830 WP_002558052.1.61928 WP_002558052.1.6251 WP_002558052.1.62754 WP_002558052.1.63108 WP_002558052.1.63590 WP_002558052.1.63798 WP_002558052.1.63925 WP_002558052.1.64551 WP_002558052.1.65124 WP_002558052.1.65375 WP_002558052.1.65409 WP_002558052.1.65726 WP_002558052.1.65921 WP_002558052.1.665 WP_002558052.1.6673 WP_002558052.1.66858 WP_002558052.1.66941 WP_002558052.1.67099 WP_002558052.1.67423 WP_002558052.1.67491 WP_002558052.1.69811 WP_002558052.1.69826 WP_002558052.1.70665 WP_002558052.1.70927 WP_002558052.1.72222 WP_002558052.1.72715 WP_002558052.1.72730 WP_002558052.1.72754 WP_002558052.1.72775 WP_002558052.1.73053 WP_002558052.1.73306 WP_002558052.1.73642 WP_002558052.1.73957 WP_002558052.1.75176 WP_002558052.1.75668 WP_002558052.1.7580 WP_002558052.1.7590 WP_002558052.1.76205 WP_002558052.1.76253 WP_002558052.1.77492 WP_002558052.1.77561 WP_002558052.1.78122 WP_002558052.1.78347 WP_002558052.1.78705 WP_002558052.1.78756 WP_002558052.1.78898 WP_002558052.1.79035 WP_002558052.1.79560 WP_002558052.1.79765 WP_002558052.1.80163 WP_002558052.1.81417 WP_002558052.1.81678 WP_002558052.1.82023 WP_002558052.1.82285 WP_002558052.1.82909 WP_002558052.1.83447 WP_002558052.1.84276 WP_002558052.1.84564 WP_002558052.1.84965 WP_002558052.1.85293 WP_002558052.1.86418 WP_002558052.1.8648 WP_002558052.1.86730 WP_002558052.1.87028 WP_002558052.1.87442 WP_002558052.1.87523 WP_002558052.1.88358 WP_002558052.1.88443 WP_002558052.1.88754 WP_002558052.1.88795 WP_002558052.1.89042 WP_002558052.1.89136 WP_002558052.1.89424 WP_002558052.1.89499 WP_002558052.1.89819 WP_002558052.1.90191 WP_002558052.1.90526 WP_002558052.1.90763 WP_002558052.1.91000 WP_002558052.1.91045 WP_002558052.1.91849 WP_002558052.1.92264 WP_002558052.1.92549 WP_002558052.1.9313 WP_002558052.1.93209 WP_002558052.1.93484 WP_002558052.1.93759 WP_002558052.1.93978 WP_002558052.1.94315 WP_002558052.1.94328 WP_002558052.1.9461 WP_002558052.1.94919 WP_002558052.1.94953 WP_002558052.1.95091 WP_002558052.1.95559 WP_002558052.1.95664 WP_002558052.1.95750 WP_002558052.1.96419 WP_002558052.1.96587 WP_002558052.1.97168 WP_002558052.1.97349 WP_002558052.1.97365 WP_002558052.1.97929 WP_002558052.1.97964 WP_002558052.1.98230 WP_002558052.1.98544 WP_002558052.1.98563 WP_002558052.1.98721 WP_002558052.1.98754 WP_002558052.1.98882 WP_002558052.1.98903 WP_002558052.1.9932 YP_101436.1.45732 gi|304360647|ref|YP_003856784.1| gi|29348114|ref|NP_811617.1| gi|60683416|ref|YP_213560.1| gi|479163776|ref|YP_007792510.1| 226186.BT_2705 272559.BF3981 295405.BF4159 gi|375360220|ref|YP_005112992.1| gi|319900946|ref|YP_004160674.1| gi|53715444|ref|YP_101436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]