SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319900956|ref|YP_004160684.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319900956|ref|YP_004160684.1|
Domain Number 1 Region: 412-611
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.16e-25
Family ABC transporter ATPase domain-like 0.00087
Further Details:      
 
Domain Number 2 Region: 130-383
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.44e-16
Family DNA repair protein MutS, domain III 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319900956|ref|YP_004160684.1|
Sequence length 615
Comment DNA mismatch repair protein MutS domain protein [Bacteroides helcogenes P 36-108]
Sequence
MNTITEISAVYRSIAEEAKRKLNKVQQQIYRIGTLRLLLFAAGVTGIIYFQSESWEIPVA
IAIVTLLPFTLLIKYHNRLFYRKDYLEKEIEVNEQELAALYYDISAFDNGEEFVDPAHLY
SYDLDVFGPHSLFQYINRTCTQPGKHRLAEWLNKHLEEQEKIRKRQEAIRELAPELKFRQ
RFRILGLLHKGKAADEAELKEWAASPAVFRTKKLLRALPASVTGTNLICLMLVITGILPA
TIYGIIWSCFVAAGFSFTGQITKAQAIYGKKLQILATYAVLLRLIEEQPMQASLLKEIKE
KIGGEKRKASRAIHRLSKLMDELDQRNNIFMYVILNGLFFWELRQIMRIEVWKEQYASDL
TRWLSAIGQTDALNSLATFAYNHPEYVYPTILGNTNESPINKKGIAPFKFCAKSLGHPLM
NREYCVHNDIEMEQRPFFIIITGANMAGKSTYLRTVGINYLLACIGTPVCARQMEFHPTR
LITSLRTSDSLNDNESYFFAELKRLKLIIDKLQSGEELFIILDEILKGTNSMDKQKGSFA
LIKQFMALQANGIIATHDLLLGTLINLFPENIRNHCFEADITNNELAFSYRLRQGIAQNM
NACFLMKKMGIAVAD
Download sequence
Identical sequences E6SRZ6
gi|319900956|ref|YP_004160684.1| WP_013546693.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]