SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319901324|ref|YP_004161052.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319901324|ref|YP_004161052.1|
Domain Number 1 Region: 461-714
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.06e-60
Family N-terminal domain of adrenodoxin reductase-like 0.00099
Further Details:      
 
Domain Number 2 Region: 316-473
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 1.99e-32
Family Dihydropyrimidine dehydrogenase, N-terminal domain 0.0019
Further Details:      
 
Domain Number 3 Region: 88-247
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.1e-30
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.006
Further Details:      
 
Domain Number 4 Region: 3-91
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 9.41e-19
Family Ferredoxin reductase FAD-binding domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319901324|ref|YP_004161052.1|
Sequence length 783
Comment glutamate synthase (NADPH), homotetrameric [Bacteroides helcogenes P 36-108]
Sequence
MNKIISKEQFSEKVFKFEVEAPLIAKSRKAGHFVIIRVDEKGERMPLTIAGADTKKGTIT
LVVQTVGLSSSKLCQLNEGDYILDVVGPLGQATHIENFGTVVCAGGGVGVAPMLPIIQAL
KEAGNRVISVLAGRNKELIILEEEVRKSSDEVIIMTDDGSYGTKGLVTEGIESVIKREKV
DKCFAIGPAIMMKFCCLLTKKYEIPTDVSLNTIMVDGTGMCGACRITVGGKTRFVCVDGP
EFDGHQVDFDEMFKRMGSFRDVEREEMNHLEASIYHAMPAEDTTATAEAGTSSATKAPMD
ELLDRKAAWREELRKSMKPKERTAIHRCPMNELDPVYRATTRTEEVNTGYTREQALTEAK
RCLDCANPTCMQGCPVSINIPAFIKNIERGELLEAARVLKHTSALPAVCGRVCPQEKQCE
SRCIHLKMNEPAVAIGNLERFVADYERESGNIVLPELAQKNGMKIAVVGSGPAGLSFAGD
MVKYGYDVTVFEALHEIGGVLKYGIPEFRLPNKIVDVEINNLEKMGVRFVKDCIVGKTVS
VEELQKEDYKGIFIASGAGLPNFMGIPGENSVNIMSSNEYLTRVNLMDASNPTTDTPLNP
AKSVIVVGGGNTAMDSCRTAKRLGAEKVRIVYRRSEAEMPARLEEVKHAKEEGIEFLTLH
NPTEYIADEKGAVKQVILQKMELGEPDASGRRSPVAIPGATVTLDIDMAIVAVGVSPNPI
VPKSVKGLELGRKNTIAVNDDMQSSIPTIYAGGDIVRGGATVILAMGDGRRAAAAMHEKL
GSL
Download sequence
Identical sequences E6SVK5
WP_013547060.1.62754 gi|319901324|ref|YP_004161052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]