SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319901343|ref|YP_004161071.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319901343|ref|YP_004161071.1|
Domain Number 1 Region: 24-419
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.68e-110
Family NagZ-like 0.00000109
Further Details:      
 
Domain Number 2 Region: 420-515,542-668
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 6.28e-55
Family Beta-D-glucan exohydrolase, C-terminal domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319901343|ref|YP_004161071.1|
Sequence length 781
Comment glycoside hydrolase 3 [Bacteroides helcogenes P 36-108]
Sequence
MNTKLVITGAFLIAMTGQTFCQKPVYKQAGAPIEYRVKDLIGRMTVEEKVAQLCCPLGWE
MYTKTGKNTVEVSALYKEKMKDAPVGSFWAVLRADPWTQKTLETGLNPELAAKALNALQK
YAVEETRLGIPVLFAEECPHGHMAIGATVFPTALSAASTWDESLMQQMGEAIALEARLQG
ANIGYGPVLDVAREPRWSRMEETFGEDPVLTSVMGVALMKGMQGDVQNDGKHLYSTLKHF
AAYGVPESGHNGSRANSGMRQLFSEYLPPFKKAVEAGAGTIMTSYNSIDGVPCTSNKFLL
TEVLRNQWGFKGFVYSDLISIEGIVGMRAAKDNKEAAAKALRAGLDMDLGGDAFGRNLKQ
AYEEGLITMDDLDRAVSNVLRLKFQMGLFENPYVSPEQAGKHIRSREHKELARRVAREGV
VLLKNDGVLPLDKHLKRIAVIGPNADMMYNQLGDYTAPQDRKEIVTVLDGVRAAVSKTTQ
VVYVKGCAVRDTTESDIPAAVAAAQRADAVILVVGGSSARDFKTKYISTGAATVSEDIKV
LPDMDCGEGFDRSSLRLLGDQEKLINAVAATGKPLVVIYIAGRAMNMNLAADKARALLAA
WYPGEQGGAGIADILFGDYNPAGRLPVSIPRSEGQLPVFYSQGTQRDYVEEKGTPLYAFG
YGLSYTKFVYSALEMRKGTDVETLQTVSCTVTNTGDRDGEEVVQLYICDEVASVSQPPIL
LKAFRRIFLKKGESRKVTFLLKKDDLAIYDDEMNYVVEPGDFKVMVGAASDDIRLKGKFR
L
Download sequence
Identical sequences E6SVM4
gi|319901343|ref|YP_004161071.1| WP_013547079.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]