SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319901380|ref|YP_004161108.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319901380|ref|YP_004161108.1|
Domain Number 1 Region: 364-480
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.58e-28
Family Cold shock DNA-binding domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 197-286
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.95e-24
Family Cold shock DNA-binding domain-like 0.0014
Further Details:      
 
Domain Number 3 Region: 282-390
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.16e-23
Family Cold shock DNA-binding domain-like 0.002
Further Details:      
 
Domain Number 4 Region: 27-134
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.58e-19
Family Cold shock DNA-binding domain-like 0.043
Further Details:      
 
Domain Number 5 Region: 125-206
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000335
Family Cold shock DNA-binding domain-like 0.02
Further Details:      
 
Domain Number 6 Region: 457-540
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000261
Family Cold shock DNA-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319901380|ref|YP_004161108.1|
Sequence length 596
Comment 30S ribosomal protein S1P [Bacteroides helcogenes P 36-108]
Sequence
MENLKNVAPIEDFNWDAYENGESVASTSHEDLEKAYDTTLNKVNDREVVDGTVIAMNKRE
VVVNIGYKSDGIIPMSEFRYNPDLKVGDTVEVYIENQEDKKGQLVLSHRKARATRSWDRV
NAALENEEIIKGYIKCRTKGGMIVDVFGIEAFLPGSQIDVKPIRDYDVFVGKTMEFKVVK
INQEFKNVVVSHKALIEAELEQQKKEIIGKLEKGQVLEGTVKNITSYGVFIDLGGVDGLI
HITDLSWGRVSDPKEVVELDQKLNVVILDFDDEKKRIALGLKQLTPHPWDALDPNLKVGD
HVKGKVVVMADYGAFIEIAAGVEGLIHVSEMSWSQHLRSAQDFMKVGDEVEAVVLTLDRE
ERKMSLGIKQLKADPWETIEEKYPLGSKHTAKVRNFTNFGVFVEIEEGVDGLIHISDLSW
TKKVKHPSEFTQIGADIDVQVLEIDKENRRLSLGHKQLEENPWDVFETVFTVGSVHEGTI
IEMLDKGAVVALPYGVEGFATPKHLVKEDGSQAQLDEKLEFKVIEFNKDAKRIILSHSRI
FEDVAKAEERAEKKASKKSSPKREETPSIQNQAASTTLGDIDALAALKEQMEAGKK
Download sequence
Identical sequences E6SVR1
gi|319901380|ref|YP_004161108.1| WP_013547116.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]