SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319901412|ref|YP_004161140.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319901412|ref|YP_004161140.1|
Domain Number 1 Region: 50-449
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.58e-92
Family NagZ-like 0.0000083
Further Details:      
 
Domain Number 2 Region: 450-699
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 1.09e-54
Family Beta-D-glucan exohydrolase, C-terminal domain 0.00071
Further Details:      
 
Domain Number 3 Region: 833-934
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000266
Family Galactose-binding domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319901412|ref|YP_004161140.1|
Sequence length 944
Comment glycoside hydrolase 3 [Bacteroides helcogenes P 36-108]
Sequence
MRKLIVAVLLLGNGALLSAQKTMKIPAIYKPVKSEMYRKGWIDFNKNGIMDIYEDPTAAI
DARIEDLLKQMSLEEKTCQMVTLYGYKRVLKDDLPTPEWKQMLWKDGIGAIDEHLNGFRQ
WGLPPSDNENVWPASRHAWALNEVQRFFVEETRLGIPVDFTNEGIRGVESYKATNFPTQL
GLGHTWNRELIHKIGFITGREARMLGYTNVYAPILDVGRDQRWGRYEEVYGESPYLVAEL
GIEMVRGMQYNHQVAATGKHFAAYSNNKGAREGMSRVDPQISPREVENIHIYPFRRVIRE
AGLLGVMSSYNDYDGIPIQGSHYWLTTRLRGEIGFRGYVVSDSDAVEYLYTKHGTAKDMK
EAIRQSVEAGLNIRCTFRSPDSFVLPLRELVKEGGLSEEIINDRVRDILRVKFLTGLFDT
PYQSDLAGADREVEKEENGSIALQASRESIVLLKNENNMLPLDLSTVKRIAVCGPNADEK
NYALTHYGPLAVEVITVLKGIQDKVSGKAEVLYTKGCDLVDANWPESEIINHPLTADEQA
EINKAAENARQSDVAVVVLGGGQRTCGENKSRSSLDLPGRQLQLLQAIQATGKPVILVLI
NGRPLSVNWADKYVPAILEAWYPGAKGGIALADVLFGDYNPGGKLTVTFPKTVGQIPFNF
PYKPASQIDGGKNPGPEGNMSRINGALYPFGYGLSYTTFEYSDLEITPKVITPNEEATVR
LKVTNTGKRAGDEVVQLYIRDVVSSVITYEKNLAGFERVHLEPGETKEVVFTLGRKHLEL
LDANMQWVVEPGDFTIMAAASSEDIRLNGLLTVEDYQMRAKAIETSKPAERVSASANREN
ACNATDGRIDTAWQGNKGDYITFALGNGIQTNKVSIAFMRDNNLPADFDIQLSGGGGQFL
TVYSGVVSEYGKMISYSFKGTTASDLRIVLNDDHVGIAEVKLTE
Download sequence
Identical sequences E6SW79
gi|319901412|ref|YP_004161140.1| WP_013547148.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]