SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319901662|ref|YP_004161390.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319901662|ref|YP_004161390.1|
Domain Number 1 Region: 341-620
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.17e-67
Family RecA protein-like (ATPase-domain) 0.0000000713
Further Details:      
 
Domain Number 2 Region: 300-374
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.94e-27
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 
Domain Number 3 Region: 2-44
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000000228
Family Rho termination factor, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319901662|ref|YP_004161390.1|
Sequence length 667
Comment transcription termination factor Rho [Bacteroides helcogenes P 36-108]
Sequence
MYNIIQLNDKNLSELQTIAQELGIKKTDSLKKEELVYKILDEQAIAGATKKVAAEKLKDE
RKGDRQKRSRVTLKTESSDKVFTANKNGNLTKPKTEAVPTTKEQPKAAETVKPATTPAAT
TSPVETSTTPKRKPGRPRKVKEDTIAPQTTETVKDSQTAEAKPSFEPKAPAAETKVEKKN
VPDENPILAEAEDDFIPIEDLPTEKIELPSELIGKFEATKAEISVLAEQPQQPQPQRPRL
RPRDNNNPPYSNNNNRNGSQQRPVQQQRSVQQPYNNSDYAVPERKPVEREKAYEFDDILT
GTGVLEIMQDGYGFLRSSDYNYLSSPDDIYVSQSQIKLFGLKTGDVVEGVIRPPKEGEKY
FPLVKVSKINGRDPAFVRDRVPFEHLTPLFPDEKFRLCKGGYSDSMSARVVDLFAPIGKG
QRALIVAQPKTGKTILMKDIANAIAANHPEVYMIMLLIDERPEEVTDMARTVNAEVIAST
FDEPAERHVKIAGIVLEKAKRMVECGHDVVIFLDSITRLARAYNTVSPASGKVLSGGVDA
NALHKPKRFFGAARNIEGGGSLTILATALIDTGSKMDEVIFEEFKGTGNMELQLDRNLSN
KRIFPAVNIVASSTRRDDLLQDKQTLDRMWILRKYLSDMNPIEAMDFVKDRLEKTKDNDE
FLLSMNS
Download sequence
Identical sequences E6SP34
gi|319901662|ref|YP_004161390.1| WP_013547398.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]