SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319902123|ref|YP_004161851.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319902123|ref|YP_004161851.1|
Domain Number 1 Region: 2-309
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.28e-110
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000229
Further Details:      
 
Domain Number 2 Region: 399-579
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.71e-56
Family NAD+-dependent DNA ligase, domain 3 0.0000309
Further Details:      
 
Domain Number 3 Region: 312-389
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.02e-25
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00064
Further Details:      
 
Domain Number 4 Region: 587-664
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000294
Family DNA ligase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319902123|ref|YP_004161851.1|
Sequence length 665
Comment DNA ligase, NAD-dependent [Bacteroides helcogenes P 36-108]
Sequence
MTAKEKIDQLRADLHRHNYNYYVLNAPEISDKEFDSMMRDLQNLEKEYPEYQDNSSPTMR
VGSDLNKNFTQVMHKYPMLSLGNTYSENEVTDFYDRVKQSLNEDFEICCELKYDGTSISL
TYENGKLVRAVTRGDGEKGDDVTDNVKTIRTIPLLLHGNYPKLFEIRGEILMPWKSFEAL
NNEREAREETLFANPRNAASGTLKLQNSAVVASRKLDAYLYYLLGEELPCNGHYENLQMA
ASWGFKISEHMKKVHSLEEIFEYISFWDTERKNLSVATDGIVLKVNSLKQQKNLGFTAKS
PRWAIAYKFQAERALTRLNKVTYQVGRTGTITPVANLDPVQLSGTVVKRASLHNADIIEG
LDLHIGDMVYVEKGGEIIPKITGVNKEARGMLLGEKVKFITHCPECGSRLIRYEGEAAHY
CPNETACPPQIKGKIEHFICRKAMDIDGLGPETVDTFYRLGLIKDAADLYNLKADDIKGL
DRMGEKSAENIINGITASKEVPFERVLFALGIRFVGETVAKRIAKSFIDIEELANANLEV
LINIDEIGEKIAKSIVTYFCNPSNRKLVERLKDAGLQLFQKEEDLNEYTDRLAGQSIVIS
GVFTHHSRDEYKILIEKNGGKNTGSISAKTNFILAGENMGPAKLEKARKLGIKIMNEDEF
LALIS
Download sequence
Identical sequences E6STL8
WP_013547855.1.62754 gi|319902123|ref|YP_004161851.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]