SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319902126|ref|YP_004161854.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319902126|ref|YP_004161854.1|
Domain Number 1 Region: 96-254
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.06e-35
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0014
Further Details:      
 
Domain Number 2 Region: 6-101
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.15e-20
Family Ferredoxin reductase FAD-binding domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319902126|ref|YP_004161854.1|
Sequence length 258
Comment dihydroorotate oxidase B, electron transfer subunit [Bacteroides helcogenes P 36-108]
Sequence
MKKYILDLTVVENIRLHTNYVLLKLTSPSPLPEMLPGQFAELRVDGSPTTFLRRPISINY
IDRQRNEVWFLIQLVGDGTRRLGEANKGDIINVVLPLGNCFTMPENPSDKLLLVGGGVGT
APMLYLGEQLAKRGSKPTFLLGARSDKDLLQLEQFAAYGEVYTTTEDGSHGEKGYVTQHS
ILKKVNFEQIYTCGPKPMMMAVAKYAKSKGINCEVSLENMMACGIGACLCCVENTTEGHL
CVCKEGPVFNINKLLWQI
Download sequence
Identical sequences E6STM1
WP_013547858.1.62754 gi|319902126|ref|YP_004161854.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]