SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319902143|ref|YP_004161871.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319902143|ref|YP_004161871.1|
Domain Number 1 Region: 115-294,422-578
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.3e-102
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000632
Further Details:      
 
Domain Number 2 Region: 2-109
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.86e-30
Family Anticodon-binding domain 0.00018
Further Details:      
 
Domain Number 3 Region: 291-416
Classification Level Classification E-value
Superfamily GAD domain-like 6.1e-29
Family GAD domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319902143|ref|YP_004161871.1|
Sequence length 585
Comment aspartyl-tRNA synthetase [Bacteroides helcogenes P 36-108]
Sequence
MYRSHTCGELRISDINKQVTLAGWVQRSRKMGGMTFIDLRDRYGITQLVFNEEVNSELCE
RANRLGREFVIRITGSVNERFSKNKNIPTGDIEIIVSELNVLNSSLTPPFTIEENTDGGD
DIRMKYRYLDLRRANVRSNLELRHKMTIEVRKYLDSQGFIEVETPILVGSTPEGARDFVV
PSRMNPGQFYALPQSPQTLKQLLMVSGFDRYFQIAKCFRDEDLRADRQPEFTQIDCEMSF
VEQDDIINLFEGMAKYLFKEIRDVELTEPFLRMPWADAMKYYGSDKPDLRFGMKFVELMD
IMKGHGFSVFDNAAYVGGICAEGAASYTRKQLDALTEFVKKPQIGAKGMVYARIEADGSV
KSSVDKFYTQEVLQEMKSAFGAKPGDLILILSGEDVMKTRKQLCELRLEVAGQLGLRDKN
KFALLWVVDFPMFEWSEEEGRLMAMHHPFTHPKEEDIPLLDTDPAAVRADAYDMVCNGIE
VGGGSIRIHDAQLQAKMFEILGFTPEKAQEQFGFLMNAFKYGAPPHGGLAYGLDRWVSIF
AGLDSIRDCIAFPKNNSGRDVMLDAPSVIDQKQLDELNLIVAVKE
Download sequence
Identical sequences E6STN8
gi|319902143|ref|YP_004161871.1| WP_013547875.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]